ITRAQ-Based Quantitative Proteomic Analysis of Processed Euphorbia Lathyris L
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
SRC Antibody - N-Terminal Region (ARP32476 P050) Data Sheet
SRC antibody - N-terminal region (ARP32476_P050) Data Sheet Product Number ARP32476_P050 Product Name SRC antibody - N-terminal region (ARP32476_P050) Size 50ug Gene Symbol SRC Alias Symbols ASV; SRC1; c-SRC; p60-Src Nucleotide Accession# NM_005417 Protein Size (# AA) 536 amino acids Molecular Weight 60kDa Product Format Lyophilized powder NCBI Gene Id 6714 Host Rabbit Clonality Polyclonal Official Gene Full Name V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) Gene Family SH2D This is a rabbit polyclonal antibody against SRC. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: QTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGG This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the Description of Target regulation of embryonic development and cell growth. SRC protein is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the -
Universidade Estadual De Campinas Instituto De Biologia
UNIVERSIDADE ESTADUAL DE CAMPINAS INSTITUTO DE BIOLOGIA VERÔNICA APARECIDA MONTEIRO SAIA CEREDA O PROTEOMA DO CORPO CALOSO DA ESQUIZOFRENIA THE PROTEOME OF THE CORPUS CALLOSUM IN SCHIZOPHRENIA CAMPINAS 2016 1 VERÔNICA APARECIDA MONTEIRO SAIA CEREDA O PROTEOMA DO CORPO CALOSO DA ESQUIZOFRENIA THE PROTEOME OF THE CORPUS CALLOSUM IN SCHIZOPHRENIA Dissertação apresentada ao Instituto de Biologia da Universidade Estadual de Campinas como parte dos requisitos exigidos para a obtenção do Título de Mestra em Biologia Funcional e Molecular na área de concentração de Bioquímica. Dissertation presented to the Institute of Biology of the University of Campinas in partial fulfillment of the requirements for the degree of Master in Functional and Molecular Biology, in the area of Biochemistry. ESTE ARQUIVO DIGITAL CORRESPONDE À VERSÃO FINAL DA DISSERTAÇÃO DEFENDIDA PELA ALUNA VERÔNICA APARECIDA MONTEIRO SAIA CEREDA E ORIENTADA PELO DANIEL MARTINS-DE-SOUZA. Orientador: Daniel Martins-de-Souza CAMPINAS 2016 2 Agência(s) de fomento e nº(s) de processo(s): CNPq, 151787/2F2014-0 Ficha catalográfica Universidade Estadual de Campinas Biblioteca do Instituto de Biologia Mara Janaina de Oliveira - CRB 8/6972 Saia-Cereda, Verônica Aparecida Monteiro, 1988- Sa21p O proteoma do corpo caloso da esquizofrenia / Verônica Aparecida Monteiro Saia Cereda. – Campinas, SP : [s.n.], 2016. Orientador: Daniel Martins de Souza. Dissertação (mestrado) – Universidade Estadual de Campinas, Instituto de Biologia. 1. Esquizofrenia. 2. Espectrometria de massas. 3. Corpo caloso. -
Funktionelle in Vitro Und in Vivo Charakterisierung Des Putativen Tumorsuppressorgens SFRP1 Im Humanen Mammakarzinom
Funktionelle in vitro und in vivo Charakterisierung des putativen Tumorsuppressorgens SFRP1 im humanen Mammakarzinom Von der Fakult¨at fur¨ Mathematik, Informatik und Naturwissenschaften der RWTH Aachen University zur Erlangung des akademischen Grades einer Doktorin der Naturwissenschaften genehmigte Dissertation vorgelegt von Diplom-Biologin Laura Huth (geb. Franken) aus Julich¨ Berichter: Universit¨atsprofessor Dr. rer. nat. Edgar Dahl Universit¨atsprofessor Dr. rer. nat. Ralph Panstruga Tag der mundlichen¨ Prufung:¨ 6. August 2014 Diese Dissertation ist auf den Internetseiten der Hochschulbibliothek online verfugbar.¨ Zusammenfassung Krebserkrankungen stellen weltweit eine der h¨aufigsten Todesursachen dar. Aus diesem Grund ist die Aufkl¨arung der zugrunde liegenden Mechanismen und Ur- sachen ein essentielles Ziel der molekularen Onkologie. Die Tumorforschung der letzten Jahre hat gezeigt, dass die Entstehung solider Karzinome ein Mehrstufen- Prozess ist, bei dem neben Onkogenen auch Tumorsuppresorgene eine entschei- dende Rolle spielen. Viele der heute bekannten Gene des WNT-Signalweges wur- den bereits als Onkogene oder Tumorsuppressorgene charakterisiert. Eine Dere- gulation des WNT-Signalweges wird daher mit der Entstehung und Progression vieler humaner Tumorentit¨aten wie beispielsweise auch dem Mammakarzinom, der weltweit h¨aufigsten Krebserkrankung der Frau, assoziiert. SFRP1, ein nega- tiver Regulator der WNT-Signalkaskade, wird in Brusttumoren haupts¨achlich durch den epigenetischen Mechanismus der Promotorhypermethylierung -
Propranolol-Mediated Attenuation of MMP-9 Excretion in Infants with Hemangiomas
Supplementary Online Content Thaivalappil S, Bauman N, Saieg A, Movius E, Brown KJ, Preciado D. Propranolol-mediated attenuation of MMP-9 excretion in infants with hemangiomas. JAMA Otolaryngol Head Neck Surg. doi:10.1001/jamaoto.2013.4773 eTable. List of All of the Proteins Identified by Proteomics This supplementary material has been provided by the authors to give readers additional information about their work. © 2013 American Medical Association. All rights reserved. Downloaded From: https://jamanetwork.com/ on 10/01/2021 eTable. List of All of the Proteins Identified by Proteomics Protein Name Prop 12 mo/4 Pred 12 mo/4 Δ Prop to Pred mo mo Myeloperoxidase OS=Homo sapiens GN=MPO 26.00 143.00 ‐117.00 Lactotransferrin OS=Homo sapiens GN=LTF 114.00 205.50 ‐91.50 Matrix metalloproteinase‐9 OS=Homo sapiens GN=MMP9 5.00 36.00 ‐31.00 Neutrophil elastase OS=Homo sapiens GN=ELANE 24.00 48.00 ‐24.00 Bleomycin hydrolase OS=Homo sapiens GN=BLMH 3.00 25.00 ‐22.00 CAP7_HUMAN Azurocidin OS=Homo sapiens GN=AZU1 PE=1 SV=3 4.00 26.00 ‐22.00 S10A8_HUMAN Protein S100‐A8 OS=Homo sapiens GN=S100A8 PE=1 14.67 30.50 ‐15.83 SV=1 IL1F9_HUMAN Interleukin‐1 family member 9 OS=Homo sapiens 1.00 15.00 ‐14.00 GN=IL1F9 PE=1 SV=1 MUC5B_HUMAN Mucin‐5B OS=Homo sapiens GN=MUC5B PE=1 SV=3 2.00 14.00 ‐12.00 MUC4_HUMAN Mucin‐4 OS=Homo sapiens GN=MUC4 PE=1 SV=3 1.00 12.00 ‐11.00 HRG_HUMAN Histidine‐rich glycoprotein OS=Homo sapiens GN=HRG 1.00 12.00 ‐11.00 PE=1 SV=1 TKT_HUMAN Transketolase OS=Homo sapiens GN=TKT PE=1 SV=3 17.00 28.00 ‐11.00 CATG_HUMAN Cathepsin G OS=Homo -
Changes of Liver Transcriptome Profiles Following Oxidative Stress in Streptozotocin-Induced Diabetes in Mice
Changes of liver transcriptome profiles following oxidative stress in streptozotocin-induced diabetes in mice Shuren Guo1, Xiaohuan Mao2, Yunmeng Yan1, Yan Zhang1 and Liang Ming1 1 Department of Clinical Laboratory, The First Affiliated Hospital of Zhengzhou University, Zhengzhou, Henan, People's Republic of China 2 Department of Clinical Laboratory, Henan Provincial People's Hospital, People's Hospital of Zhengzhou Uni- versity, Zhengzhou, Henan, People's Republic of China ABSTRACT Background. Oxidative-stress (OS) was causal in the development of cell dysfunction and insulin resistance. Streptozotocin (STZ) was an alkylation agent that increased reactive oxygen species (ROS) levels. Here we aimed to explore the oxidative-stress and related RNAs in the liver of STZ-induced diabetic mice. Methods. RNA-sequencing was performed using liver tissues from STZ induced diabetic mice and controls. Pathway and Gene Ontology (GO) analyses were utilized to annotate the target genes. The differentially expressed RNAs involved in the peroxisome pathway were validated by qRT-PCR. The glucose metabolite and OS markers were measured in the normal control (NC) and STZ-induced diabetic mellitus (DM) group. Results. The levels of serum Fasting insulin, HbA1c, Malondialdehyde (MDA) and 8-iso-prostaglandin F2α (8-iso-PGF2α) were significant higher in DM groups than NC group, while SOD activity decreased significantly in DM groups. We found 416 lncRNAs and 910 mRNAs were differentially expressed in the STZ-induced diabetic mice compared to the control group. OS associated RNAs were differentially expressed in the liver of STZ-induced diabetic mice. Conclusion. This study confirmed that the OS was increased in the STZ-induced DM mice as evidenced by the increase of lipid peroxidation product MDA and 8-iso-PGF2α, Submitted 11 November 2019 identified aberrantly expressed lncRNAs and mRNAs in STZ-induced diabetic mice. -
A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated. -
Supplementary Materials
1 Supplementary Materials: Supplemental Figure 1. Gene expression profiles of kidneys in the Fcgr2b-/- and Fcgr2b-/-. Stinggt/gt mice. (A) A heat map of microarray data show the genes that significantly changed up to 2 fold compared between Fcgr2b-/- and Fcgr2b-/-. Stinggt/gt mice (N=4 mice per group; p<0.05). Data show in log2 (sample/wild-type). 2 Supplemental Figure 2. Sting signaling is essential for immuno-phenotypes of the Fcgr2b-/-lupus mice. (A-C) Flow cytometry analysis of splenocytes isolated from wild-type, Fcgr2b-/- and Fcgr2b-/-. Stinggt/gt mice at the age of 6-7 months (N= 13-14 per group). Data shown in the percentage of (A) CD4+ ICOS+ cells, (B) B220+ I-Ab+ cells and (C) CD138+ cells. Data show as mean ± SEM (*p < 0.05, **p<0.01 and ***p<0.001). 3 Supplemental Figure 3. Phenotypes of Sting activated dendritic cells. (A) Representative of western blot analysis from immunoprecipitation with Sting of Fcgr2b-/- mice (N= 4). The band was shown in STING protein of activated BMDC with DMXAA at 0, 3 and 6 hr. and phosphorylation of STING at Ser357. (B) Mass spectra of phosphorylation of STING at Ser357 of activated BMDC from Fcgr2b-/- mice after stimulated with DMXAA for 3 hour and followed by immunoprecipitation with STING. (C) Sting-activated BMDC were co-cultured with LYN inhibitor PP2 and analyzed by flow cytometry, which showed the mean fluorescence intensity (MFI) of IAb expressing DC (N = 3 mice per group). 4 Supplemental Table 1. Lists of up and down of regulated proteins Accession No. -
(ESI) for Toxicology Research
Electronic Supplementary Material (ESI) for Toxicology Research. This journal is © The Royal Society of Chemistry 2014 Supplementary data 1 Particle preparation and characterization 1.1 SWCNT preparation The purchased SWCNTs (P2-SWNTs, Carbon Solutions, Inc. CA, USA) have a poor dispersibility and colloidal stability in aqueous medium. To make well-dispersed SWCNTs in aqueous medium with a proper colloidal stability for the duration of the experiments, the purchased SWCNTs were accurately weighted and suspended in dimethyl sulfoxide (DMSO) to 0.125 mg/mL, followed by ultrasonication for 30 minutes in a water bath sonicator (B3510, Branson Ultrasonics, 40KHz). In the last minute of ultrasonication, the SWCNTs-DMSO suspension was rapidly diluted 5 times by injecting a stabilization buffer (5 mg/mL BSA and 10 mM NaCl in MilliQ water). The mixture, referred to as as-dispersed SWCNTs (AD-SWCNTs), resulted in a clear dark-brown suspension. No sedimentation of AD-SWCNTs was observed for weeks at room temperature indicating a good colloidal stability. To remove the majority of DMSO and free BSA, AD-SWCNTs were pelleted by centrifugation at 16,000 g, 4 °C for 30 min followed by three times wash with 10 mM NaCl in MilliQ water under the same conditions. The colloidal stability and surface charge of SWCNTs at each step were monitored by dynamic light scattering analysis (DLS) (see below). The depletion of DMSO and BSA was monitored by UV-Visible absorption analysis (see below). The SWCNTs aggregates and metallic impurities were characterized by TEM and TEM-EDX (see below). After the washing steps, SWCNTs were re-dispersed in MilliQ water with 10 mM NaCl to about 0.4 mg/mL, which was used in the experiments and here referred to as prepared SWCNTs. -
FT-Like Proteins Induce Transposon Silencing in the Shoot Apex During
FT-like proteins induce transposon silencing in the PNAS PLUS shoot apex during floral induction in rice Shojiro Tamakia,b, Hiroyuki Tsujib,1, Ayana Matsumotob, Akiko Fujitab, Zenpei Shimatanib,c, Rie Teradac, Tomoaki Sakamotoa, Tetsuya Kurataa, and Ko Shimamotob,2 aPlant Global Education Project and bLaboratory of Plant Molecular Genetics, Graduate School of Biological Sciences, Nara Institute of Science and Technology, Ikoma, Nara 630-0192, Japan; and cLaboratory of Genetics and Breeding Science, Faculty of Agriculture, Meijo University, Tempaku, Nagoya, Aichi 468-8502, Japan Edited by Robert L. Fischer, University of California, Berkeley, CA, and approved January 13, 2015 (received for review September 12, 2014) Floral induction is a crucial developmental step in higher plants. is mediated by 14-3-3 proteins (GF14s) and that Hd3a–14-3- Florigen, a mobile floral activator that is synthesized in the leaf and 3–OsFD1 forms a ternary structure called the florigen activation transported to the shoot apex, was recently identified as a protein complex (FAC) on C-box elements in the promoter of OsMADS15, encoded by FLOWERING LOCUS T (FT) and its orthologs; the rice ariceAP1 ortholog (12). florigen is Heading date 3a (Hd3a) protein. The 14-3-3 proteins me- Individual meristems of rice can be manually dissected with diate the interaction of Hd3a with the transcription factor OsFD1 to relative ease under a microscope (Fig. S1). We exploited this ability form a ternary structure called the florigen activation complex on to address two questions about florigen (i) How are Hd3a and its OsMADS15 APETALA1 the promoter of , a rice ortholog. -
Centre for Arab Genomic Studies a Division of Sheikh Hamdan Award for Medical Sciences
Centre for Arab Genomic Studies A Division of Sheikh Hamdan Award for Medical Sciences The Catalogue for Transmission Genetics in Arabs CTGA Database tRNA Methyltransferase 1, S. Cerevisiae, Homolog of Alternative Names planus. These findings are further bolstered by the TRMT1 fact that mutations in two other RNA- N2,N2-Dimethylguanosine-26 tRNA methyltransferase genes, NSUN2 and FTSJ1, have Methyltransferase been associated with intellectual disability. tRNA(m(2,2)G26)Dimethyltransferase Record Category Molecular Genetics Gene locus The TRMT1 gene is located on the short arm of chromosome 19 and spans a length of 12.6 kb of WHO-ICD DNA. Its coding sequence is spread across 18 N/A to gene loci exons and it encodes a 72.2 kDa protein product comprised of 659 amino acids. An additional 69.3 Incidence per 100,000 Live Births kDa isoform of the TRMT1 protein exists due to an N/A to gene loci alternatively spliced transcript variant. The gene is widely expressed in the human body, particularly in OMIM Number the nervous system, intestine, spleen, kidney and 611669 lung. Mode of Inheritance Epidemiology in the Arab World N/A to gene loci Saudi Arabia Monies et al. (2017) studied the findings of 1000 Gene Map Locus diagnostic panels and exomes carried out at a next 19p13.13 generation sequencing lab in Saudi Arabia. One patient, a 13-year-old male, presented with speech Description delay, intellectual disability, learning disability, The TRMT1 gene encodes a methyltransferase hypotonia and seizures. Using whole exome enzyme that acts on tRNA. This enzyme, which sequencing, a homozygous mutation consists of a zinc finger motif and an (c.1245_1246del, p.L415fs) was identified in exon arginine/proline rich region at its C-terminus, is 10 of the patient’s TRMT1 gene. -
Congenital Disorders of Glycosylation from a Neurological Perspective
brain sciences Review Congenital Disorders of Glycosylation from a Neurological Perspective Justyna Paprocka 1,* , Aleksandra Jezela-Stanek 2 , Anna Tylki-Szyma´nska 3 and Stephanie Grunewald 4 1 Department of Pediatric Neurology, Faculty of Medical Science in Katowice, Medical University of Silesia, 40-752 Katowice, Poland 2 Department of Genetics and Clinical Immunology, National Institute of Tuberculosis and Lung Diseases, 01-138 Warsaw, Poland; [email protected] 3 Department of Pediatrics, Nutrition and Metabolic Diseases, The Children’s Memorial Health Institute, W 04-730 Warsaw, Poland; [email protected] 4 NIHR Biomedical Research Center (BRC), Metabolic Unit, Great Ormond Street Hospital and Institute of Child Health, University College London, London SE1 9RT, UK; [email protected] * Correspondence: [email protected]; Tel.: +48-606-415-888 Abstract: Most plasma proteins, cell membrane proteins and other proteins are glycoproteins with sugar chains attached to the polypeptide-glycans. Glycosylation is the main element of the post- translational transformation of most human proteins. Since glycosylation processes are necessary for many different biological processes, patients present a diverse spectrum of phenotypes and severity of symptoms. The most frequently observed neurological symptoms in congenital disorders of glycosylation (CDG) are: epilepsy, intellectual disability, myopathies, neuropathies and stroke-like episodes. Epilepsy is seen in many CDG subtypes and particularly present in the case of mutations -
Interacción Célula Sinovial-Fibrina Como Mecanismo Patogénico Y Oportunidad Terapéutica En Artritis Reumatoide
UNIVERSIDAD COMPLUTENSE DE MADRID FACULTAD DE CIENCIAS QUÍMICAS DEPARTAMENTO DE BIOQUÍMICA Y BIOLOGÍA MOLECULAR I TESIS DOCTORAL Interacción célula sinovial-fibrina como mecanismo patogénico y oportunidad terapéutica en artritis reumatoide MEMORIA PARA OPTAR AL GRADO DE DOCTOR PRESENTADA POR Antonio Gabucio López DIRECTORA Olga Sánchez Pernaute Madrid, 2017 © Antonio Gabucio López, 2016 Universidad Complutense de Madrid FACULTAD DE CIENCIAS QUÍMICAS TESIS DOCTORAL Interacción célula sinovial-fibrina como mecanismo patogénico y oportunidad terapéutica en artritis reumatoide PRESENTADA POR Antonio Gabucio López Facultad de Ciencias Químicas Directora Olga Sánchez Pernaute I A todos los que me han ayudado por hacer la vida más fácil y a todos los que me han “des”-ayudado por enseñarme a ser más fuerte II III AGRADECIMIENTOS A la Dra. Olga Sánchez Pernaute, directora del estudio, por su incansable apoyo y asesoramiento científico. Al doctor Gabriel Herrero-Beaumont Cuenca, jefe de servicio de reumatología de la Fundación Jiménez Díaz, por su insustituible apoyo y sin el cual, esta tesis no hubiera sido posible. A los pacientes anónimos, objeto y objetivo del estudio, sin cuya existencia y solidaridad nada de esto tendría sentido. A la Sociedad Española de Reumatología, por el apoyo prestado en el origen de este proyecto. A la Fundación Conchita Rábago de Jiménez Díaz por su soporte financiero. A todas aquellas personas que de una u otra manera han contribuido al desarrollo de esta tesis doctoral. IV V ÍNDICE RESUMEN / ABSTRACT..............................................................................................