Phylogeny of the Ascomycetous Yeasts and the Renaming of Pichia Anomala to Wickerhamomyces Anomalus
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Genome Diversity and Evolution in the Budding Yeasts (Saccharomycotina)
| YEASTBOOK GENOME ORGANIZATION AND INTEGRITY Genome Diversity and Evolution in the Budding Yeasts (Saccharomycotina) Bernard A. Dujon*,†,1 and Edward J. Louis‡,§ *Department Genomes and Genetics, Institut Pasteur, Centre National de la Recherche Scientifique UMR3525, 75724-CEDEX15 Paris, France, †University Pierre and Marie Curie UFR927, 75005 Paris, France, ‡Centre for Genetic Architecture of Complex Traits, and xDepartment of Genetics, University of Leicester, LE1 7RH, United Kingdom ORCID ID: 0000-0003-1157-3608 (E.J.L.) ABSTRACT Considerable progress in our understanding of yeast genomes and their evolution has been made over the last decade with the sequencing, analysis, and comparisons of numerous species, strains, or isolates of diverse origins. The role played by yeasts in natural environments as well as in artificial manufactures, combined with the importance of some species as model experimental systems sustained this effort. At the same time, their enormous evolutionary diversity (there are yeast species in every subphylum of Dikarya) sparked curiosity but necessitated further efforts to obtain appropriate reference genomes. Today, yeast genomes have been very informative about basic mechanisms of evolution, speciation, hybridization, domestication, as well as about the molecular machineries underlying them. They are also irreplaceable to investigate in detail the complex relationship between genotypes and phenotypes with both theoretical and practical implications. This review examines these questions at two distinct levels offered by the broad evolutionary range of yeasts: inside the best-studied Saccharomyces species complex, and across the entire and diversified subphylum of Saccharomycotina. While obviously revealing evolutionary histories at different scales, data converge to a remarkably coherent picture in which one can estimate the relative importance of intrinsic genome dynamics, including gene birth and loss, vs. -
Expanding the Knowledge on the Skillful Yeast Cyberlindnera Jadinii
Journal of Fungi Review Expanding the Knowledge on the Skillful Yeast Cyberlindnera jadinii Maria Sousa-Silva 1,2 , Daniel Vieira 1,2, Pedro Soares 1,2, Margarida Casal 1,2 and Isabel Soares-Silva 1,2,* 1 Centre of Molecular and Environmental Biology (CBMA), Department of Biology, University of Minho, Campus de Gualtar, 4710-057 Braga, Portugal; [email protected] (M.S.-S.); [email protected] (D.V.); [email protected] (P.S.); [email protected] (M.C.) 2 Institute of Science and Innovation for Bio-Sustainability (IB-S), University of Minho, 4710-057 Braga, Portugal * Correspondence: [email protected]; Tel.: +351-253601519 Abstract: Cyberlindnera jadinii is widely used as a source of single-cell protein and is known for its ability to synthesize a great variety of valuable compounds for the food and pharmaceutical industries. Its capacity to produce compounds such as food additives, supplements, and organic acids, among other fine chemicals, has turned it into an attractive microorganism in the biotechnology field. In this review, we performed a robust phylogenetic analysis using the core proteome of C. jadinii and other fungal species, from Asco- to Basidiomycota, to elucidate the evolutionary roots of this species. In addition, we report the evolution of this species nomenclature over-time and the existence of a teleomorph (C. jadinii) and anamorph state (Candida utilis) and summarize the current nomenclature of most common strains. Finally, we highlight relevant traits of its physiology, the solute membrane transporters so far characterized, as well as the molecular tools currently available for its genomic manipulation. -
Supplementary Materials
Supplementary Materials C4Y5P9|C4Y5P9_CLAL4 ------------------MS-EDLTKKTE------ELSLDSEKTVLSSKEEFTAKHPLNS 35 Q9P975|IF4E_CANAL ------------------MS-EELAQKTE------ELSLDS-KTVFDSKEEFNAKHPLNS 34 Q6BXX3|Q6BXX3_DEBHA --MKVF------TNKIAKMS-EELSKQTE------ELSLENKDTVLSNKEEFTAKHPLNN 45 C5DJV3|C5DJV3_LACTC ------------------MSVEEVTQKTG-D-----LNIDEKSTVLSSEKEFQLKHPLNT 36 P07260|IF4E_YEAST ------------------MSVEEVSKKFE-ENVSVDDTTATPKTVLSDSAHFDVKHPLNT 41 I2JS39|I2JS39_DEKBR MQMNLVGRTFPASERTRQSREEKPVE----AEVAKPEEEKKDVTVLENKEEFTVKHPLNS 56 A0A099P1Q5|A0A099P1Q5_PICKU ------------------MSTEELNN----ATKDLSLDEKKDVTALENPAEFNVKHPLNS 38 P78954|IF4E1_SCHPO ------------------MQTEQPPKESQTENTVSEPQEKALRTVFDDKINFNLKHPLAR 42 *. : *.:.. .* **** C4Y5P9|C4Y5P9_CLAL4 KWTLWYTKPQTNKSETWSDLLKPVITFSSVEEFWGIYNSIPVANQLPMKSDYHLFKEGIK 95 Q9P975|IF4E_CANAL RWTLWYTKPQTNKSENWHDLLKPVITFSSVEEFWGIYNSIPPANQLPLKSDYHLFKEGIR 94 Q6BXX3|Q6BXX3_DEBHA KWTLWYTKPQVNKSENWHDLLKPVITFSSVEEFWGIYNSIPQANQLPMKSDYHLFKEGIK 105 C5DJV3|C5DJV3_LACTC KWTLWYTKPPVDKSESWSDLLRPVTSFETVEEFWAIHNAIPKPRYLPLKSDYHLFRNDIR 96 P07260|IF4E_YEAST KWTLWYTKPAVDKSESWSDLLRPVTSFQTVEEFWAIIQNIPEPHELPLKSDYHVFRNDVR 101 I2JS39|I2JS39_DEKBR KWTLWYTKPAVDKNESWADLLKPIVSFDTVEEFWGIYHAVPKAVDLPLKSDYHLFRNDIK 116 A0A099P1Q5|A0A099P1Q5_PICKU TWTLWYTKPAVDNTESWADLLKPVVTFNTVEEFWGIFHAIPKVNELPLKSDYHLFRGDIK 98 P78954|IF4E1_SCHPO PWTLWFLMPPTPG-LEWNELQKNIITFNSVEEFWGIHNNINPASSLPIKSDYSFFREGVR 101 ****: * . * :* : : :*.:*****.* : : **:**** .*: .:: C4Y5P9|C4Y5P9_CLAL4 PEWEDEQNAKGGRWQYSFNNKRDVAQVINDLWLRGLLAVIGETIEDD---ENEVNGIVLN 152 Q9P975|IF4E_CANAL PEWEDEANSKGGKWQFSFNKKSEVNPIINDLWLRGLLAVIGETIEDE---ENEVNGIVLN -
42 Genome Scale Model Reconstruction of the Methylotrophic
GENOME SCALE MODEL RECONSTRUCTION OF THE METHYLOTROPHIC YEAST OGATAEA POLYMORPHA Simone Schmitz, RWTH Aachen University, Germany [email protected] Ulf W. Liebal, RWTH Aachen University, Germany Aarthi Ravikrishnan, Department of Biotechnology, Bhupat and Jyoti Mehta School of Biosciences; Institute of Technology Madras, India Constantin V.L. Schedel, RWTH Aachen University, Germany Lars M. Blank, RWTH Aachen University, Germany Birgitta E. Ebert, RWTH Aachen University, Germany Key words: Ogataea (Hansenula) polymorpha, metabolic model, phenotype microarray experiments, methylotrophic yeast Ogataea polymorpha is a thermotolerant, methylotrophic yeast with significant industrial applications. It is a promising host to generate platform chemicals from methanol, derived e.g. from carbon capture and utilization streams. Full development of the organism into a production strain requires additional strain design, supported by metabolic modeling on the basis of a genome-scale metabolic model. However, to date, no genome-scale metabolic model is available for O. polymorpha. To overcome this limitation, we used a published reconstruction of the closely related yeast Pichia pastoris as reference and corrected reactions based on KEGG annotations. Additionally, we conducted phenotype microarray experiments to test O. polymorpha’s metabolic capabilities to grown on or respire 192 different carbon sources. Over three-quarter of the substrate usage was correctly reproduced by the model. However, O. polymorpha failed to metabolize eight substrates and gained 38 new substrates compared to the P. pastoris reference model. To enable the usage of these compounds, metabolic pathways were inferred from literature and database searches and potential enzymes and genes assigned by conducting BLAST searches. To facilitate strain engineering and identify beneficial mutants, gene-protein-reaction relationships need to be included in the model. -
Identification and Phylogeny of Ascomycetous Yeasts from Analysis
Antonie van Leeuwenhoek 73: 331–371, 1998. 331 © 1998 Kluwer Academic Publishers. Printed in the Netherlands. Identification and phylogeny of ascomycetous yeasts from analysis of nuclear large subunit (26S) ribosomal DNA partial sequences Cletus P. Kurtzman∗ & Christie J. Robnett Microbial Properties Research, National Center for Agricultural Utilization Research, Agricultural Research Ser- vice, U.S. Department of Agriculture, Peoria, Illinois 61604, USA (∗ author for correspondence) E-mail: [email protected] Received 19 June 1998; accepted 19 June 1998 Key words: Ascomycetous yeasts, phylogeny, ribosomal DNA, systematics Abstract Approximately 500 species of ascomycetous yeasts, including members of Candida and other anamorphic genera, were analyzed for extent of divergence in the variable D1/D2 domain of large subunit (26S) ribosomal DNA. Divergence in this domain is generally sufficient to resolve individual species, resulting in the prediction that 55 currently recognized taxa are synonyms of earlier described species. Phylogenetic relationships among the ascomycetous yeasts were analyzed from D1/D2 sequence divergence. For comparison, the phylogeny of selected members of the Saccharomyces clade was determined from 18S rDNA sequences. Species relationships were highly concordant between the D1/D2 and 18S trees when branches were statistically well supported. Introduction lesser ranges of nDNA relatedness than those found among heterothallic species. Disadvantages of nDNA reassociation studies in- Procedures commonly used for yeast identification clude the need for pairwise comparisons of all isolates rely on the appearance of cellular morphology and dis- under study and that resolution is limited to the ge- tinctive reactions on a standardized set of fermentation netic distance of sister species, i.e., closely related and assimilation tests. -
Pathogenicity Classification of Fungi Status December 2014 (CGM/141218-03)
Classification of Organisms: Pathogenicity classification of fungi Status December 2014 (CGM/141218-03) COGEM advice CGM/141218-03 Pathogenicity classification of fungi COGEM advice CGM/141218-03 Dutch Regulations Genetically Modified Organisms In the Decree on Genetically Modified Organisms (GMO Decree) and its accompanying more detailed Regulations (GMO Regulations) genetically modified micro-organisms are grouped in four pathogenicity classes, ranging from the lowest pathogenicity Class 1 to the highest Class 4.1 The pathogenicity classifications are used to determine the containment level for working in laboratories with GMOs. A micro-organism of Class 1 should at least comply with one of the following conditions: a) the micro-organism does not belong to a species of which representatives are known to be pathogenic for humans, animals or plants, b) the micro-organism has a long history of safe use under conditions without specific containment measures, c) the micro-organism belongs to a species that includes representatives of class 2, 3 or 4, but the particular strain does not contain genetic material that is responsible for the virulence, d) the micro-organism has been shown to be non-virulent through adequate tests. A micro-organism is grouped in Class 2 when it can cause a disease in humans or animals whereby it is unlikely to spread within the population while an effective prophylaxis, treatment or control strategy exists, as well as an organism that can cause a disease in plants. A micro-organism is grouped in Class 3 when it can cause a serious disease in humans or animals whereby it is likely to spread within the population while an effective prophylaxis, treatment or control strategy exists. -
A Report of Candida Blankii Fungemia and Possible Endocarditis in an Immunocompetent Individual and the Review of Literature
Open Access Case Report DOI: 10.7759/cureus.14945 A Report of Candida blankii Fungemia and Possible Endocarditis in an Immunocompetent Individual and the Review of Literature Vidya S. Kollu 1 , Pramod K. Kalagara 2 , Shehla Islam 3 , Asmita Gupte 3 1. Department of Infectious Diseases and Global Medicine, College of Medicine, University of Florida, Gainesville, USA 2. Department of Hospital Medicine, Covenant Healthcare, Saginaw, USA 3. Division of Infectious Diseases, Veterans Affairs Medical Center, Gainesville, USA Corresponding author: Vidya S. Kollu, [email protected] Abstract Candida blankii is an emerging pathogenic fungus, first identified in 1968 as a new species. In the past five years, it has been identified in cystic fibrosis patient's airways and as fungemia in immunocompromised patients (post lung transplant and preterm neonates). It has been postulated to be a possible opportunistic pathogen based on the published case reports. We report a case of C. blankii fungemia with possible endocarditis in an immunocompetent individual. To our knowledge, this is also the first case of C. blankii bloodstream infection reported in an adult patient (age > 18 years). The C. blankii isolate from our patient had high minimum inhibitory concentrations (MICs) to azoles similar to the published reports. There is a dearth of literature guiding the treatment of this organism, given the variable susceptibility pattern and lack of data. Here, we describe successful treatment of possible C. blankii endocarditis with a combination of polyene and echinocandin antifungal agents. Categories: Cardiology, Internal Medicine, Infectious Disease Keywords: candida blankii, fungal endocarditis, fungemia, antifungal resistance, antifungal duration Introduction C. blankii is an emerging fungal pathogen [1]. -
The Phylogeny of Plant and Animal Pathogens in the Ascomycota
Physiological and Molecular Plant Pathology (2001) 59, 165±187 doi:10.1006/pmpp.2001.0355, available online at http://www.idealibrary.com on MINI-REVIEW The phylogeny of plant and animal pathogens in the Ascomycota MARY L. BERBEE* Department of Botany, University of British Columbia, 6270 University Blvd, Vancouver, BC V6T 1Z4, Canada (Accepted for publication August 2001) What makes a fungus pathogenic? In this review, phylogenetic inference is used to speculate on the evolution of plant and animal pathogens in the fungal Phylum Ascomycota. A phylogeny is presented using 297 18S ribosomal DNA sequences from GenBank and it is shown that most known plant pathogens are concentrated in four classes in the Ascomycota. Animal pathogens are also concentrated, but in two ascomycete classes that contain few, if any, plant pathogens. Rather than appearing as a constant character of a class, the ability to cause disease in plants and animals was gained and lost repeatedly. The genes that code for some traits involved in pathogenicity or virulence have been cloned and characterized, and so the evolutionary relationships of a few of the genes for enzymes and toxins known to play roles in diseases were explored. In general, these genes are too narrowly distributed and too recent in origin to explain the broad patterns of origin of pathogens. Co-evolution could potentially be part of an explanation for phylogenetic patterns of pathogenesis. Robust phylogenies not only of the fungi, but also of host plants and animals are becoming available, allowing for critical analysis of the nature of co-evolutionary warfare. Host animals, particularly human hosts have had little obvious eect on fungal evolution and most cases of fungal disease in humans appear to represent an evolutionary dead end for the fungus. -
Fungi Associated with Ips Acuminatus (Coleoptera: Curculionidae) in Ukraine with a Special Emphasis on Pathogenicity of Ophiostomatoid Species
EUROPEAN JOURNAL OF ENTOMOLOGYENTOMOLOGY ISSN (online): 1802-8829 Eur. J. Entomol. 114: 77–85, 2017 http://www.eje.cz doi: 10.14411/eje.2017.011 ORIGINAL ARTICLE Fungi associated with Ips acuminatus (Coleoptera: Curculionidae) in Ukraine with a special emphasis on pathogenicity of ophiostomatoid species KATERYNA DAVYDENKO 1, 2, RIMVYDAS VASAITIS 2 and AUDRIUS MENKIS 2 1 Ukrainian Research Institute of Forestry & Forest Melioration, Pushkinska st. 86, 61024 Kharkiv, Ukraine; e-mail: [email protected] 2 Department of Forest Mycology and Plant Pathology, Uppsala BioCenter, Swedish University of Agricultural Sciences, P.O. Box 7026, SE-75007, Uppsala, Sweden; e-mails: [email protected], [email protected] Key words. Coleoptera, Curculionidae, pine engraver beetle, Scots pine, Ips acuminatus, pathogens, Ophiostoma, Diplodia pinea, insect-fungus interaction Abstract. Conifer bark beetles are well known to be associated with fungal complexes, which consist of pathogenic ophiostoma- toid fungi as well as obligate saprotroph species. However, there is little information on fungi associated with Ips acuminatus in central and eastern Europe. The aim of the study was to investigate the composition of the fungal communities associated with the pine engraver beetle, I. acuminatus, in the forest-steppe zone in Ukraine and to evaluate the pathogenicity of six associated ophiostomatoid species by inoculating three-year-old Scots pine seedlings with these fungi. In total, 384 adult beetles were col- lected from under the bark of declining and dead Scots pine trees at two different sites. Fungal culturing from 192 beetles resulted in 447 cultures and direct sequencing of ITS rRNA from 192 beetles in 496 high-quality sequences. -
GRAS Notice for Pichia Kudriavzevii ASCUSDY21 for Use As a Direct Fed Microbial in Dairy Cattle
GRAS Notice for Pichia kudriavzevii ASCUSDY21 for Use as a Direct Fed Microbial in Dairy Cattle Prepared for: Division of Animal Feeds, (HFV-220) Center for Veterinary Medicine 7519 Standish Place Rockville, Maryland 20855 Submitted by: ASCUS Biosciences, Inc. 6450 Lusk Blvd Suite 209 San Diego, California 92121 GRAS Notice for Pichia kudriavzevii ASCUSDY21 for Use as a Direct Fed Microbial in Dairy Cattle TABLE OF CONTENTS PART 1 – SIGNED STATEMENTS AND CERTIFICATION ................................................................................... 9 1.1 Name and Address of Organization .............................................................................................. 9 1.2 Name of the Notified Substance ................................................................................................... 9 1.3 Intended Conditions of Use .......................................................................................................... 9 1.4 Statutory Basis for the Conclusion of GRAS Status ....................................................................... 9 1.5 Premarket Exception Status .......................................................................................................... 9 1.6 Availability of Information .......................................................................................................... 10 1.7 Freedom of Information Act, 5 U.S.C. 552 .................................................................................. 10 1.8 Certification ................................................................................................................................ -
The Species-Specific Acquisition and Diversification of a Novel Family Of
bioRxiv preprint doi: https://doi.org/10.1101/2020.10.05.322909; this version posted October 7, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 1 The Species-specific Acquisition and Diversification of a Novel 2 Family of Killer Toxins in Budding Yeasts of the Saccharomycotina. 3 4 Lance R. Fredericks1, Mark D. Lee1, Angela M. Crabtree1, Josephine M. Boyer1, Emily A. Kizer1, Nathan T. 5 Taggart1, Samuel S. Hunter2#, Courtney B. Kennedy1, Cody G. Willmore1, Nova M. Tebbe1, Jade S. Harris1, 6 Sarah N. Brocke1, Paul A. Rowley1* 7 8 1Department of Biological Sciences, University of Idaho, Moscow, ID, USA 9 2iBEST Genomics Core, University of Idaho, Moscow, ID 83843, USA 10 #currently at University of California Davis Genome Center, University of California, Davis, 451 Health Sciences Dr., Davis, CA 11 95616 12 *Correspondence: [email protected] 13 14 Abstract 15 Killer toxins are extracellular antifungal proteins that are produced by a wide variety of fungi, 16 including Saccharomyces yeasts. Although many Saccharomyces killer toxins have been 17 previously identified, their evolutionary origins remain uncertain given that many of the se genes 18 have been mobilized by double-stranded RNA (dsRNA) viruses. A survey of yeasts from the 19 Saccharomyces genus has identified a novel killer toxin with a unique spectrum of activity 20 produced by Saccharomyces paradoxus. The expression of this novel killer toxin is associated 21 with the presence of a dsRNA totivirus and a satellite dsRNA. -
Clasificación Del Clado De Ogataea, Un Punto De Vista Integral
INSTITUTO POLITÉCNICO NACIONAL ESCUELA NACIONAL DE CIENCIAS BIOLÓGICAS Clasificación del clado de Ogataea, un punto de vista integral. PROYECTO DE INVESTIGACIÓN (TESIS) QUE PARA OBTENER EL TÍTULO DE QUÍMICO BACTERIÓLOGO PARASITÓLOGO PRESENTA: ERIKA BERENICE MARTÍNEZ RUIZ MÉXICO, DF. 2013 El presente trabajo se realizó en el Laboratorio de Micología Médica del Departamento de Microbiología de la Escuela Nacional de Ciencias Biológicas, del IPN. Se llevó a cabo bajo la dirección de la Dra. Aída Verónica Rodríguez Tovar y el Dr. Néstor Octavio Pérez Ramírez. Se contó con la colaboración de la Dra. Paulina Estrada de los Santos del Laboratorio de Microbiología Industrial del Departamento de Microbiología de la ENCB, del IPN. AGRADECIMIENTOS Gracias al Instituto Politécnico Nacional, porque al ser una de las Instituciones de más alto Reconocimiento a Nivel Nacional y figurar entre las mejores a nivel Internacional, me brindó un lugar en su matrícula, una preparación académica de excelencia y una nueva sangre que con orgullo portaré día con día porque “Soy Politécnico por convicción y no por circunstancia”. Gracias a la Escuela Nacional de Ciencias Biológicas, que más que una escuela se volvió un segundo hogar en estos últimos 5 años para mí, porque me dio las armas para estar a la altura de los mejores, porque con orgullo intentaré seguir dejando en alto el nombre de mi escuela. Además de brindarnos el apoyo en equipos, instalaciones y materiales para llevar a cabo este proyecto. Dra. Aída y Dr. Néstor, mis asesores, ¡gracias! porque confiaron en mí en un momento de incertidumbre, porque me apoyaron, me escucharon, me impulsaron a seguir adelante y me transmitieron una parte de sus amplios conocimientos.