DOCSLIB.ORG

Chapter 4: Psychology in the Laboratory

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Chapter 4: Psychology in the Laboratory Chapter 4: Psychology in the Laboratory PSK306-History of Psychology Assoc. Prof. Okan Cem Çırakoğlu [email protected] Transitions of the 19th Century • In the 19th century, Europe and North America were going through significant social and economic changes Psycholohy: Social, Economic and Cultural Context of 19th Century What People Knew About Psychology: An Overview Psychology Experimental Mental Science Philosophy Psychology as a subject of studies developed in the 19th century within at least two fields. One was experimental science, including physics, biology, physiology, or medicine. The other was so-called mental philosophy. Psychological Knowledge in mid-1800 • Sensation • Emotion • Intellect • Volition • Limited knowledge on brain functions • Physics and biology (sensation) • Consicous and uncosncious processes Psychology: Science and Popular Beliefs • A fashion, a trend, and a faith— spiritualism was a belief that the living could correspond with the deceased through special channels of communication. • Clairvoyance or clear seeing, stood for the supposed extrasensory power of an individual, that is, the power to see or feel objects or events that could not be perceived by the senses or measured objectively. Psychology: Science and Popular Beliefs • Phrenology (or cranioscopy) A theory connecting the size and shape of the brain with human behavior and the individual’s personality. Gall divided the brain into two large groups and 37 zones representing emotional characteristics (such as desire to live, reverence, or imitation) and intellectual characteristics (such as order, calculation, and comparison). ▫ Phrenology turned into a popular movement, with dozens of phrenology societies formed in Europe and the United States. In the 19th century, phrenology became a big business: people were willing to pay money to get evaluated. Case In Point • 150 years ago people believed in extrasensory perception and other supernatural abilities Given the statistics shown in the box in your book, why do you think there are relatively large portions of people maintaining such beliefs? Some Discoveries of the 19th Century Physiology that Impacted Psychology Studies of the The membrane The all-or-none speed of nervous theory of nerve principle of impulses conduction nerve conduction The new method Theories of the Studies of dark of staining eye convergence, and light individual nerves binocular vision, adaptation and cell color blindness structures Identification of Studies of Identification of the visual and reflexes of the several motor speech centers in brain and the areas in the the brain spinal cord brain Early Measurements in Psychology • The existence of remarkably consistent differences in measurement between any two observers had been established in several experiments and was labeled as personal equation. • The beginning of experimental studies of the reaction time. The main finding of these studies was that personal psychological characteristics such as attention or anticipation could significantly affect reaction time and behavior in general. Early Measurements in Psychology • Psychophysics, according to Gustav T. Fechner (1801–1887) was an exact science of the functional relations of dependency between body and mind. • In 1850, Fechner suggested a possibility that subjective estimations of measurements such as weight or length may develop in an arithmetic series in response to a geometric series of physical changes. He found the supporting evidence in experiments on weights, brightness, tactile perception, and visual differences. Gustav Fechner • Gustav Fechner was physicist, philosopher, writer, poet, and scientist who wanted us to enjoy the beauty of his carefully crafted experiments • Fechner’s main work, Elements of Psychophysics, was published in 1860. • Fechner’s law states that the magnitude of a subjective sensation increases proportional to the logarithm of the stimulus intensity (1801-1887) S = subjective experience S = k log I I = physical intensity k is a constant Major Findings by Hermann Ebbinghaus (1850-1909) Wilhelm Wundt • Wilhelm Wundt was founder of the first psychological laboratory in Leipzig, Germany. Thirty-three American and scores of students from other countries worked on their doctoral degrees under Wundt’s supervision. • Oswald Külpe, Hugo Münsterberg • Vladimir Bekhterev, Ivan Pavlov (1832-1920) • Stanley Hall, James McKeen Cattell, Lightner Witmer, E. B. Titchener Wilhelm Wundt’s Academic Accomplishments Resistance to Experimental Psychology • Financial limitations • Cultural-ideological obstacles ▫ Chemistry, physics, engineering supported more ▫ Reluctancy to technical side of exp. psy Laboratories in the United States • In the United States, psychologists found a favorable environment. A combination of public financial support, tuition, and private donations created an infrastructure with available resources for experimental research and training of future psychologists. Two great psychologists, Stanley Hall and James Cattell, were among the first returning American students who, after studying with Wundt, brought back their experiences and aspirations. • The first laboratory of psychology was organized by G. Stanley Hall at the Johns Hopkins University in Maryland early in 1883. • James Cattell formally opened a psychology lab in 1887 at the University of Pennsylvania. Experimental Psychology in Selected Countries Experimental Psychology in Selected Countries, cont. Wilhelm Wundt’s Views • 1. Body and Mind Interaction ▫ Measurable variables should be products of Sensory activities Movements • 2. Concept of Psychological Compounding ▫ Basic parts of experience: sensations and feelings ▫ The process by which these elements connect is psychological compounding ▫ Process of organizing mental elements: apperception • 3. Method of Experimental Inspection • 4. Higher mental process Goals for Psychology • The analysis of elements of consicousness • Finding the manner of connection of these elements • Finding the laws of this connection Wundt’s Psychologies • Physiological Psychology: The study of experiences functionally related to physiological processes. • “Second Psychology”: The psychological study of experiences that are incarnated in the brain and the nervous system and appear in the form of myths, fairy tales, and beliefs. Wundt’s Legacy Psychological Acts According to Franz Brentano William Titchener • The nature of psychological phenomena is in mental elements, those elementary “bricks” from which the larger mental structures are created. The problem was to identify how these complex structures were formed. • The task of the psychologist is to describe these elements and learn how they interconnect. In the process of introspection, a scientist should not use common labels, such as, “I see the table and it is brown.” Instead, the scientist should describe the elements of his or her conscious experience. (1867-1927) • Sensations as mental elements have four basic characteristics: quality, intensity, duration, and clearness Birth of the American Psychological Association In December 1892 at the University of Pennsylvania, the first annual meeting of the American Psychological Association took place, representing 31 original members (18 had attended the first meeting). The composition of the association was diverse and included psychiatrists, philosophers, experimental psychologists, and experts in education G. Stanley Hall (called pedagogists). They were all men. 1844-1924 The average age of the members was 35, with the most mature 54 years old..
Load more

Recommended publications
  • Critical Neuroscience
    Choudhury_bindex.indd 391 7/22/2011 4:08:46 AM Critical Neuroscience Choudhury_ffirs.indd i 7/22/2011 4:37:11 AM Choudhury_ffirs.indd ii 7/22/2011 4:37:11 AM Critical Neuroscience A Handbook of the Social and Cultural Contexts of Neuroscience Edited by Suparna Choudhury and Jan Slaby A John Wiley & Sons, Ltd., Publication Choudhury_ffirs.indd iii 7/22/2011 4:37:11 AM This edition first published 2012 © 2012 Blackwell Publishing Ltd Blackwell Publishing was acquired by John Wiley & Sons in February 2007. Blackwell’s publishing program has been merged with Wiley’s global Scientific, Technical, and Medical business to form Wiley-Blackwell. Registered Office John Wiley & Sons Ltd, The Atrium, Southern Gate, Chichester, West Sussex, PO19 8SQ, UK Editorial Offices 350 Main Street, Malden, MA 02148-5020, USA 9600 Garsington Road, Oxford, OX4 2DQ, UK The Atrium, Southern Gate, Chichester, West Sussex, PO19 8SQ, UK For details of our global editorial offices, for customer services, and for information about how to apply for permission to reuse the copyright material in this book please see our website at www.wiley.com/wiley-blackwell. The right of Suparna Choudhury and Jan Slaby to be identified as the authors of the editorial material in this work has been asserted in accordance with the UK Copyright, Designs and Patents Act 1988. All rights reserved. No part of this publication may be reproduced, stored in a retrieval system, or transmitted, in any form or by any means, electronic, mechanical, photocopying, recording or otherwise, except as permitted by the UK Copyright, Designs and Patents Act 1988, without the prior permission of the publisher.
    [Show full text]
  • Erica Fretwell SENSORY EXPERIMENTS Sensory Experiments PSYCHOPHYSICS, RACE, and the AESTHETICS of FEELING
    S E N S O R Y E X P E R I M E N T S Psychophysics, RACE, and the Aesthetics of feeling Erica Fretwell SENSORY EXPERIMENTS Sensory Experiments PSYCHOPHYSICS, RACE, AND THE AESTHETICS OF FEELING Erica Fretwell Duke University Press Durham and London 2020 © 2020 Duke University Press All rights reserved Printed in the United States of Amer i ca on acid- free paper ∞ Designed by Amy Ruth Buchanan Typeset in Arno and Avenir by Westchester Publishing Services Library of Congress Cataloging- in- Publication Data Names: Fretwell, Erica, [date] author. Title: Sensory experiments : psychophysics, race, and the aesthetics of feeling / Erica Fretwell. Description: Durham : Duke University Press, 2020. | Includes bibliographical references and index. Identifiers:lccn 2019054741 (print) | lccn 2019054742 (ebook) | isbn 9781478009863 (hardcover) | isbn 9781478010937 (paperback) | isbn 9781478012450 (ebook) Subjects: lcsh: Psychophysics. | Senses and sensation— Social aspects. | Racism—United States—Psychological aspects. | Racism—United States—History—19th century. | Science—Social aspects—United States—History—19th century. Classification:lcc bf237 .f74 2020 (print) | lcc bf237 (ebook) | ddc 152.10973/09034—dc23 lc record available at https://lccn.loc.gov/2019054741 lc ebook record available at https://lccn.loc.gov/2019054742 Duke University Press gratefully acknowl- edges the University at Albany, SUNY, which provided funds toward the publication of this book. IN MEMORY OF STEVEN FRETWELL CONTENTS Acknowl edgments ​ix Introduction: NEW SENSATION 1
    [Show full text]
  • The Psychophysics of Consciousness: a Hypothesis
    S.R. Joye The Psychophysics of Consciousness The Psychophysics of Consciousness: A Hypothesis "Hypothesis: a very poor choice of word to designate the supreme spiritual act by which the dust-cloud of experience takes on form and is kindled at the fire of knowledge." Pierre Teilhard de Chardin August 9, 2013 S.R. Joye, B.S. Electrical Engineering, M.A. Asian Philosophy, CIIS Doctoral Candidate, Department of Philosophy & Religion Concentration in Philosophy, Cosmology, and Consciousness PARP 9600 – Doctoral Comprehensive Exam Paper Professor Allan Combs School of Consciousness and Transformation Summer Semester 2013 Comp. Exam Part II The Psychophysics of Consciousness The Psychophysics of Consciousness: A Hypothesis Abstract Gustav Fechner, the German experimental psychologist, coined the term psychophysics in 1860, publishing the first mathematical equation to model human consciousness.1 Fechner assumed that any future approaches to consciousness would include mathematical and physical underpinnings. In 1995, the cognitive scientist and philosopher David Chalmers coined the phrase "the hard problem" as being that of connecting consciousness with some physical substrate. According to Chalmers, "The really hard problem of consciousness is the problem of experience. Most existing theories of consciousness either deny the phenomenon, explain something else, or elevate the problem to an eternal mystery."2 As Chalmers points out, unfortunately, the modern scientific community has not yet produced a model of consciousness supported by mathematics and physics, thus no progress in Fecher's "psychophysics." However there is growing interest among the scientific community in string theory, the only branch of mathematical geometry that has successfully explained recent discoveries in high energy particle physics.
    [Show full text]
  • Life and Death of Vladimir Mikhailovich Bekhterev
    DOI: 10.1590/0004-282X20150124 ARTICLEHISTORICAL NOTE Life and death of Vladimir Mikhailovich Bekhterev Vida e morte de Vladimir Mikhailovich Bekhterev Péricles Maranhão-Filho1, Eliana Teixeira Maranhão2,3, Eliasz Engelhardt4 ABSTRACT Vladimir Mikhailovich Bekhterev was a Russian innovative neuroscientist, extraordinary in the study, diagnosis, and research in the fields of neurology, psychology, morphology, physiology, and psychiatry. Considering the ample and multifaceted scientific feats, only some are touched in a very brief manner. However, it is necessary to highlight his contributions to neurology, with the description of structures, signs and syndromes, to physiology, including reflexology, which later underpinned behaviorism, to psychology, including objective psychology and suggestion. His accomplishments and legacy remained until the present days. Some comments about the scenery that involved his death are also presented. Keywords: Bekhterev, neurology, reflexology, psychology, suggestion. RESUMO Vladimir Mikhailovich Bekhterev foi um neurocientista russo inovador, extraordinário no estudo, diagnóstico, e pesquisa nas áreas da neurologia, psicologia, morfologia, fisiologia e psiquiatria. Considerando seus feitos científicos amplos e multifacetados, apenas alguns são tocados de um modo muito abreviado. Entretanto, é necessário realçar suas contribuições à neurologia, com a descrição de estruturas, sinais e síndromes, à fisiologia, compreendendo a reflexologia, que mais tarde fundamentou o behaviorismo, à psicologia, incluindo
    [Show full text]
  • Empfindungsfähigkeit Und Moralischer Status Eine Kritik Der Pathozentrischen Ethik
    Empfindungsfähigkeit und moralischer Status Eine Kritik der pathozentrischen Ethik Inauguraldissertation zur Erlangung des Doktorgrades der Philosophie im Fachbereich A Geistes- und Kulturwissenschaften der Bergischen Universität Wuppertal vorgelegt von Erasmus Scheuer aus Düsseldorf Wuppertal, im Januar 2018 Die Dissertation kann wie folgt zitiert werden: urn:nbn:de:hbz:468-20180503-133904-3 [http://nbn-resolving.de/urn/resolver.pl?urn=urn%3Anbn%3Ade%3Ahbz% 3A468-20180503-133904-3] alles bleibt wie es ist Geheimnis in einem Geheimnis Muster in einem Muster (Norbert Scheuer – Nichts) Meinen Eltern, Elvira und Norbert Scheuer Vorwort Der Pathozentrismus betrachtet die Leidens- oder Empfindungsfähigkeit aller, auch nichtmenschlicher Spezies als zentrales moralisches Kriterium. Diese Arbeit hat die pathozentrische Position zum Gegenstand und bewegt sich bewusst zwischen Kritik und Verteidigung eines solchen Ansatzes. Einerseits liegen die Schwächen des Pa- thozentrismus m.E. mehr oder weniger offen zu Tage, da die Kluft zwischen Empfin- dungen des Menschen und den Empfindungen anderer Spezies nur schwer inner- halb eines naturwissenschaftlich-physikalistischen Weltbildes überbrückbar erscheint. Andererseits vertrete ich als Verfasser dieser Arbeit die Ansicht, dass eine Erweiterung der Moralobjekte über die Menschen hinaus erfolgen muss, dass das Leiden anderer Kreaturen Teil einer jeden ethischen Betrachtung sein sollte. Der Pa- thozentrismus vertritt mit seinem Kriterium der Leidens- bzw. Empfindungsfähigkeit eine ethische Position, die vom Ansatz her eine Erweiterung der Moralobjekte an- strebt. Aus diesem Grund liegt meine Sympathie beim Pathozentristen. Infolgedes- sen versucht diese Arbeit, einerseits die Kritik am Pathozentrismus aufzuzeigen, an- dererseits dem Pathozentristen auch Argumente an die Hand zu geben, die es ihm erlauben, seine Position zu verteidigen. Der Pathozentrist hat nach meiner Ansicht zwei schwerwiegende und grundlegende Probleme, wenn er seine Ethik innerhalb eines tendenziell physikalistischen Weltbildes zu verteidigen sucht.
    [Show full text]
  • Weber-Fechner Law Forrest W
    Plant Pathology and Microbiology Publications Plant Pathology and Microbiology 7-2010 Weber-Fechner Law Forrest W. Nutter Jr. Iowa State University, [email protected] Follow this and additional works at: http://lib.dr.iastate.edu/plantpath_pubs Part of the Agricultural Science Commons, Agriculture Commons, and the Plant Pathology Commons The ompc lete bibliographic information for this item can be found at http://lib.dr.iastate.edu/ plantpath_pubs/71. For information on how to cite this item, please visit http://lib.dr.iastate.edu/ howtocite.html. This Book Chapter is brought to you for free and open access by the Plant Pathology and Microbiology at Iowa State University Digital Repository. It has been accepted for inclusion in Plant Pathology and Microbiology Publications by an authorized administrator of Iowa State University Digital Repository. For more information, please contact [email protected]. Weber-Fechner Law Abstract Several models have been proposed in the field of psychophysics to quantify relationships between any stimulus (e.g., touch, sound, light, and smell) and the perceived response by individuals. One such model is referred to as the Weber-Fechner Law. The eW ber −Fechner Law, however, is not one law, but two separate laws: Weber's Law and Fechner's Law. Moreover, not all human senses respond to stimuli according to Fechner's law (in fact many do not). Weber's Law and special cases such as Fechner's Law are each based on the “just noticeable difference threshold” concept. Disciplines Agricultural Science | Agriculture | Plant Pathology Comments This chapter is from Encyclopedia of Research Design (2010): 1612, doi:10.4135/9781412961288.n494.
    [Show full text]
  • Chapter 4 – Wilhelm Wundt and the Founding of Psychology
    CHAPTER 6 – GERMAN PSYCHOLOGISTS OF THE 19TH & EARLY 20TH CENTURIES Dr. Nancy Alvarado German Rivals to Wundt Ernst Weber & Gustav Fechner -- psychophysicists Hermann Ebbinghaus -- memory Franz Brentano Carl Stumpf Oswald Kulpe Weber & Fechner Ernst Weber (1795-1878) Weber published “De tactu” describing the minimum amount of tactile stimulation needed to experience a sensation of touch – the absolute threshold. Using weights he found that holding versus lifting them gave different results (due to muscles involved). He used a tactile compass to study how two-point discrimination varied across the body. On the fingertip .22 cm, on the lips .30 cm, on the back 4.06 cm. Just Noticeable Difference (JND) Weber studied how much a stimulus must change in order for a person to sense the change. How much heavier must a weight be in order for a person to notice that it is heavier? This amount is called the just noticeable difference JND The JND is not fixed but varies with the size of the weights being compared. R k JND can be expressed as a ratio: R where R is stimulus magnitude and k is a constant and R means the change in R ( usually means change) Gustav Fechner (1801-1887) Fechner related the physical and psychological worlds using mathematics. Fechner (1860) said: “Psychophysics, already related to physics by name must on one hand be based on psychology, and [on] the other hand promises to give psychology a mathematical foundation.” (pp. 9-10) Fechner extended Weber’s work because it provided the right model for accomplishing this. Fechner’s Contribution Fechner called Weber’s finding about the JND “Weber’s Law.” Fechner’s formula describes how the sensation is related to increases in stimulus size: S k log R where S is sensation, k is Weber’s constant and R is the magnitude of a stimulus The larger the stimulus magnitude, the greater the amount of difference needed to produce a JND.
    [Show full text]
  • Elements of Psychophysics Fechner Pdf
    Elements of psychophysics fechner pdf Continue German experimental psychologist, physicist and philosopher Gustav Fechner BornGustav Theodore Fechner (1801-04-19)19 April 1801Grogros Seurchen (near Muskau), Saxony, Sacred Roman Empire 18 November 1887 (1887-11-18) (age 86)Leipzig, SaxonyNationalityGermanFormationMedizinische Academy Carl Gustav Karus (PhD, 1835)Famous forWeber-Fechner legalThe careerFieldsPsychologyInstitutionsLeipzig UniversityThesisDe variis intensitatem vis Galvanicae metiendi methodis (183)5) Famous studentsHuman LotzeInfluinencesImmanuel KantInfluInflu HeundtWilliam JamesAlfred North WhiteheadCharles HartshorneErnst WeberSigmund FreudFriedrich PaulsenLudwig von Bertalanffy Gustav Theodore Fechner (/ˈfɛxnər/; German: ˈfɛçnɐ; April 19, 1801 - November 18, 1887 - German experimental psychologist, philosopher and physicist. Early pioneer of experimental psychology and founder of psychophysics, he inspired many scientists and philosophers of ⁡ the 20th century. that became known as the Weber-Fechner Law. Fechner's early life and scientific career were born in Grosh-Schurchen, near Muskau, in Lower Lusatia, where his father was a pastor. Although Fechner was raised by his religious father, he became an atheist in later life. He was first educated in Sorau (now Dawn in Western Poland). In 1817 he studied medicine at Medizinische Akademie by Carl Gustav Karus in Dresden and since 1818 at the University of Leipzig, the city in which he spent the rest of his life. In 1835 he received his doctorate in Leipzig. In 1834 he was appointed Professor of Physics in Leipzig. But in 1839 he contracted an eye disorder while studying the phenomena of color and vision, and, after suffering many, resigned. Subsequently, while recovering, he turned to the study of the mind and its relationship with the body, giving public lectures on the topics discussed in his books.
    [Show full text]
  • Lecture 1 Intro
    1 Introduction Chapter 1 Introduction • Welcome to Our World • Thresholds and the Dawn of Psychophysics • Sensory Neuroscience and the Biology of Perception Introduction What do we mean by “Sensation & Perception?” • Sensation: The ability to detect a stimulus and, perhaps, to turn that detection into a private experience. • Perception: The act of giving meaning to a detected sensation. Sensation and perception are central to mental life. • Without them, how would we gain knowledge of the world? Introduction Psychologists typically study sensation and perception. • Also studied by biologists, computer scientists, medical doctors, neuroscientists, and many other fields Introduction The study of sensation and perception is a scientific pursuit and requires scientific methods. • Thresholds: Finding the limits of what can be perceived. • Scaling: Measuring private experience. • Signal detection theory: Measuring difficult decisions. • Sensory neuroscience: The biology of sensation and perception. • Neuroimaging: An image of the mind. Thresholds and the Dawn of Psychophysics Gustav Fechner (1801–1887) invented “psychophysics” and is often considered to be the true founder of experimental psychology. Fechner was an ambitious and hard- working young man who worked himself to the point of exhaustion. • Damaged his eyes by staring at the sun while performing vision experiments Figure 1.3 Gustav Fechner invented psychophysics and is thought by some to be the true founder of experimental psychology Thresholds and the Dawn of Psychophysics Fechner thought about the philosophical relationship between mind and matter. • Dualism: The mind has an existence separate from the material world of the body. • Materialism: The only thing that exists is matter, and that all things, including mind and consciousness, are the results of interactions between bits of matter.
    [Show full text]
  • Personality in Russian Psychology and Psychiatry
    The International Journal of Person Centered Medicine Vol 2 Issue 1 pp 104-108 FROM THE FOURTH GENEVA CONFERENCE ON PERSON CENTERED MEDICINE: CONTRIBUTIONS TO THE ADVANCEMENT OF PERSON-CENTERED CARE Personality in Russian psychology and psychiatry Valery N. Krasnov MD MSc Director, Moscow Research Institute of Psychiatry, Moscow, Russian Federation Abstract A review of historical developments in Russian psychiatry that support person-centered approaches is presented. A proper orientation to the patient’s personality and a correct use of the intact personality properties along with an understanding of patient’s values and societal context as the basis for individual treatment policy are rooted in Russian psychiatric tradition which evolved in close interaction with national psychological schools, specifically, the cultural-historical concept of mental development (Vygotsky) and activity theory (Leontyev et al.). Contemporary psychiatric practice is frequently based on other theories. However, there are exceptions, i.e. a naturalistic study that is used as an illustration of effective person- oriented treatment of organic brain damage. This article describes a cohort of patients with organic psychosyndrome (without pronounced dementia features) of predominantly cerebrovascular nature that developed in persons exposed to the Chernobyl nuclear disaster in 1986. Keywords Chernobyl, doctor-patient relationship, humanistic context, multidisciplinary teamwork, person-centered psychiatry, personality as facilitating rehabilitation factor, Russian psychology and psychiatry, Correspondence address Prof. Valery Krasnov, Director, Moscow Research Institute of Psychiatry, Poteshnaya 3, Moscow 107076, Russian Federation. E-mail: [email protected] Accepted for publication: 14 March 2012 Introduction distant supervision for some therapeutic procedures increase the distance between doctor and patient and reduce the time of face-to-face communication.
    [Show full text]
  • History of Psychology Documentation Release 0.1
    History of Psychology Documentation Release 0.1 Britt Anderson (and others) Dec 16, 2019 Contents 1 Preface 3 1.1 1 A meandering introduction.......................................3 1.1.1 1.1 Some technical comments.................................4 2 What is Psychology? 7 2.1 1 What is psychology?..........................................7 2.1.1 1.1 Aristotle...........................................8 2.1.2 1.2 John Stuart Mill.......................................8 2.1.3 1.3 Wilhelm Wundt.......................................8 2.1.4 1.4 Edward Bradford Titchener.................................8 2.1.5 1.5 William James.......................................8 2.1.6 1.6 John Watson.........................................8 2.1.7 1.7 George Trumball Ladd and Robert Sessions Woodworth.................8 2.1.8 1.8 David G. Myers.......................................9 2.2 2 What’s in a name?...........................................9 2.3 3 Some comments............................................9 2.4 4 A Few Final Questions.........................................9 3 Philosophical Antecedents 11 3.1 1 Where to begin?............................................ 12 3.2 2 Philosophers and Psychology..................................... 12 3.2.1 2.1 Descartes (1596 - 1650)................................... 12 3.2.2 2.2 John Locke (1632 - 1704).................................. 16 3.2.3 2.3 Other names - Other stories................................. 18 3.2.4 2.4 Question for Review, Discussion, and a Scavanger Hunt.................. 20 4
    [Show full text]
  • Sensation & Perception, 4E
    1 Introduction Chapter 1 Introduction • Thresholds and the Dawn of Psychophysics • Sensory Neuroscience and the Biology of Perception Introduction What do we mean by “Sensation & Perception?” • Sensation: The ability to detect a stimulus (convert to nervous system activity) • Perception: The act of giving meaning to a detected sensation. (Schieber say “integration” “objects”) • Cognition: The manipulation of perceptual objects (in the service of goals) Sensory processes are not available to consciousness but the products of perceptual processes are the objects of awareness Introduction Sensation and perception are central to mental life. • Without them, how would we gain knowledge of the world? Introduction The study of sensation and perception is a scientific pursuit and requires scientific methods. • Thresholds: Finding the limits of what can be perceived. • Scaling: Measuring private experience. • Signal detection theory: Measuring difficult decisions. • Sensory neuroscience: The biology of sensation and perception. • Neuroimaging: An image of the mind. Thresholds and the Dawn of Psychophysics Psychophysical Thresholds Thresholds and the Dawn of Psychophysics First, some formal definitions: • Just noticeable difference (JND): The smallest detectable difference between two stimuli, or the minimum change in a stimulus that can be correctly judged as different from a reference stimulus; also known as difference threshold. • Absolute threshold: Minimum amount of stimulation necessary for a person to detect a stimulus 50% of the time. The Concept of Absolute Threshold Ideal Absolute Threshold The Concept of Absolute Threshold But…. early experimental psychologists like Fechner discovered that humans were not ideal observers. Instead, behavior at the boundary of sensory sensitivity appeared to reflect probabilistic processes rather than ideal detection.
    [Show full text]