DOCSLIB.ORG

Elements of Psychophysics Fechner Pdf

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Elements of Psychophysics Fechner Pdf Elements of psychophysics fechner pdf Continue German experimental psychologist, physicist and philosopher Gustav Fechner BornGustav Theodore Fechner (1801-04-19)19 April 1801Grogros Seurchen (near Muskau), Saxony, Sacred Roman Empire 18 November 1887 (1887-11-18) (age 86)Leipzig, SaxonyNationalityGermanFormationMedizinische Academy Carl Gustav Karus (PhD, 1835)Famous forWeber-Fechner legalThe careerFieldsPsychologyInstitutionsLeipzig UniversityThesisDe variis intensitatem vis Galvanicae metiendi methodis (183)5) Famous studentsHuman LotzeInfluinencesImmanuel KantInfluInflu HeundtWilliam JamesAlfred North WhiteheadCharles HartshorneErnst WeberSigmund FreudFriedrich PaulsenLudwig von Bertalanffy Gustav Theodore Fechner (/ˈfɛxnər/; German: ˈfɛçnɐ; April 19, 1801 - November 18, 1887 - German experimental psychologist, philosopher and physicist. Early pioneer of experimental psychology and founder of psychophysics, he inspired many scientists and philosophers of ⁡ the 20th century. that became known as the Weber-Fechner Law. Fechner's early life and scientific career were born in Grosh-Schurchen, near Muskau, in Lower Lusatia, where his father was a pastor. Although Fechner was raised by his religious father, he became an atheist in later life. He was first educated in Sorau (now Dawn in Western Poland). In 1817 he studied medicine at Medizinische Akademie by Carl Gustav Karus in Dresden and since 1818 at the University of Leipzig, the city in which he spent the rest of his life. In 1835 he received his doctorate in Leipzig. In 1834 he was appointed Professor of Physics in Leipzig. But in 1839 he contracted an eye disorder while studying the phenomena of color and vision, and, after suffering many, resigned. Subsequently, while recovering, he turned to the study of the mind and its relationship with the body, giving public lectures on the topics discussed in his books. While lying in bed, Fechner had an idea of the relationship between mental sensations and material sensations. This understanding has proved to be significant in the development of psychology, as there is now a quantitative link between the mental and physical worlds. Fechner's contributions were published in chemical and physical works, as well as the chemical works of Joan-Batista Biota and Louis Juak Tinaard from French. He also wrote several poems and humorous works, such as Vergleichende Anatomie der Engel (1825), written under the pseudonym Dr. Misans. The epochal work of Elemente der Psychophysics Fechner was his Elemente der Psychophysik (1860). He began with a monistic thought that bodily facts and conscious facts, though not a accomplished one are different sides of the same reality. Its originality lies in trying to discover an exact mathematical connection between the two. The most famous result of his requests is a law known as the Weber-Fechner Act, which can be expressed as follows: In order for the intensity of sensation to increase in arithmetic progression, the stimulus must increase exponentially. The law has been deemed extremely useful, but to fail for very weak and very strong feelings. Within its useful range, Fechner's law is that sensation is a logarmic function of physical intensity. S.S. Stevens noted that such a law does not take into account the fact that perceived relationships between stimuli (e.g., black, dark gray, gray, light gray and white) remain unchanged with changes in overall intensity (i.e., in the level of document coverage). In his famous 1961 article entitled Honoring Fechner and Repealing His Law, he suggested that the intensity of stimulation should be linked to perception through the Law of Power. Fechner's overall formula for getting on the number of units in any sensation is the S q c journal R, where the S stands for the sensation, the R for the stimulus is numerically evaluated, and with for constant, which must be separately defined by the experiment in each particular order of sensitivity. Fechner's reasoning was criticized on the grounds that while incentives are composite, the feelings are not. Every sensation, says William James, presents itself as an indivisible unit; and it is utterly impossible to read any clear meaning in that they are mass units combined. Fechner's color pattern of Benham's disk In 1838, he also studied the still mysterious illusion of perceiving what is still known as the Fechner color effect, in which the colors are visible in a moving pattern of black and white. In 1894, the English journalist and amateur scholar Charles Benham allowed English speakers to learn about this effect by inventing a rotating peak bearing his name. It is not known whether Fechner and Benham met face-to-face for any reason. Median In 1878 Fechner published a paper in which he developed the notion of the median. Later he delved into experimental aesthetics and thought to define the shapes and sizes of aesthetically pleasing objects. He mainly used the size of the paintings as a database. In his 1876 Vorschule der Aesthetik he used the method of extreme ranges for subjective judgments. Fechner is generally credited with introducing the median into official data analysis. Synesthesia In 1871, Fechner reported the first empirical study of colored lettering among 73 synesthetes. His work in the 1880s was followed by the work of Francis Galton. The Callosum Corps split one of Fechner's speculations about consciousness, touching the brain. time, it was known that the brain is bilateral symmetrical and that there is a deep separation between the two halves that are connected by a connective band of fibers called the body of calluses. Fechner suggested that if the calluses of the hull were separated, the result would be two separate streams of consciousness - the mind would become two. However, Fechner believed that his theory would never be tested; he was wrong. In the mid-twentieth century, Roger Sperry and Michael Gazzaniga worked on epileptic patients with a sectarian-hull callous and noticed that Fechner's idea was correct. The Gold Section fechner built ten rectangles with different width-to-length ratios and asked numerous observers to choose the best and worst shape of the rectangle. He was concerned about the visual appeal of rectangles with different proportions. Participants were explicitly instructed to ignore any associations they had with rectangles, such as objects of a similar ratio. The rectangles selected as the best by the highest number of participants and as the worst in terms of the number of participants had a ratio of 0.62 (21:34). This ratio is known as the golden section (or gold ratio) and refers to the ratio of rectangle width to length, which is the most attractive to the eyes. Carl Stumpf was involved in this study. However, there was some constant controversy about the experiment itself, since the fact that Fechner deliberately abandoned the results of the study did not fit his needs became known, with many mathematicians including Mario Livio refuting the outcome of the experiment. Two parts of normal distribution In his posthumously published Kollektivmasslehre (1897), Fechner presented sweistig Gauss'sche Gesetz or two parts of normal distribution, to accommodate the asymmetry he observed in empirical frequency distributions in many areas. The distribution was independently rediscovered by several authors working in various fields. Fechner's paradox in 1861, Fechner reported, that if he looked at the light with a darkened piece of glass above one eye, he closed that eye, the light seemed to become brighter, though less light came into his eyes. This phenomenon became known as the Fechner paradox. He has been the subject of numerous scientific papers, including in the 2000s. Fechner's influence, along with Wilhelm Wundt and Hermann von Helmholtz, is recognized as one of the founders of modern experimental psychology. His clearest contribution was to demonstrate that because the mind was receptive to measurement and mathematical treatment, psychology had the potential to become a quantitative science. Theorists such as Immanuil Kant have long stated it was impossible, and so the science of psychology was also impossible. Although he had a huge influence on psychophysics, there were few real disciples of his general philosophy. Ernst Mach was inspired by his work on psychophysics. William James also admired his work: in 1904 he wrote an admiring introduction to the English translation of Fahlein's Buchlein vom Leben nach dem Tode (Little Book of Life after Death). He also influenced Sigmund Freud, who refers to Fechner, presenting the concept of psychic terrain in his Interpretation of Dreams, which he illustrates with a microscope metaphor. Fechner's world concept was highly animistic. He felt the thrill of life all over the world, in plants, in earth, stars, full of the universe. Man stands halfway between the souls of plants and the souls of the stars, who are angels. God, the soul of the universe, must be conceived as an existence similar to that of humans. Natural laws are just ways of revealing God's perfection. In his latest work, Fechner, in an age but full of hope, contrasts this joyful day view of the world with a dead, dreary night view of materialism. Fechner's work in aesthetics is also important. He conducted experiments to show that certain abstract shapes and proportions naturally please our senses, and gave some new illustrations of the work of the aesthetic association. Charles Hartshorn saw him as a predecessor in Alfred North Whitehead's philosophy and regretted that Fechner's philosophical work had been ignored for so long. Fechner's position towards his predecessors and contemporaries is not very clearly defined. He was a distant disciple of Schelling, learned a lot from Baruch Spinoza, G.V. Leibniz, Johann Friedrich Herbart, Arthur Schopenhauer and Christian Hermann Weisse, and strongly rejected G.V. F. Hegel and Rudolf Herman Lotze's monadism. Fechner's work continues to influence modern science, inspiring researchers such as Ian Kenderink, Farley Norman, David Higer and others to further explore human perception abilities.
Load more

Recommended publications
  • Erica Fretwell SENSORY EXPERIMENTS Sensory Experiments PSYCHOPHYSICS, RACE, and the AESTHETICS of FEELING
    S E N S O R Y E X P E R I M E N T S Psychophysics, RACE, and the Aesthetics of feeling Erica Fretwell SENSORY EXPERIMENTS Sensory Experiments PSYCHOPHYSICS, RACE, AND THE AESTHETICS OF FEELING Erica Fretwell Duke University Press Durham and London 2020 © 2020 Duke University Press All rights reserved Printed in the United States of Amer i ca on acid- free paper ∞ Designed by Amy Ruth Buchanan Typeset in Arno and Avenir by Westchester Publishing Services Library of Congress Cataloging- in- Publication Data Names: Fretwell, Erica, [date] author. Title: Sensory experiments : psychophysics, race, and the aesthetics of feeling / Erica Fretwell. Description: Durham : Duke University Press, 2020. | Includes bibliographical references and index. Identifiers:lccn 2019054741 (print) | lccn 2019054742 (ebook) | isbn 9781478009863 (hardcover) | isbn 9781478010937 (paperback) | isbn 9781478012450 (ebook) Subjects: lcsh: Psychophysics. | Senses and sensation— Social aspects. | Racism—United States—Psychological aspects. | Racism—United States—History—19th century. | Science—Social aspects—United States—History—19th century. Classification:lcc bf237 .f74 2020 (print) | lcc bf237 (ebook) | ddc 152.10973/09034—dc23 lc record available at https://lccn.loc.gov/2019054741 lc ebook record available at https://lccn.loc.gov/2019054742 Duke University Press gratefully acknowl- edges the University at Albany, SUNY, which provided funds toward the publication of this book. IN MEMORY OF STEVEN FRETWELL CONTENTS Acknowl edgments ​ix Introduction: NEW SENSATION 1
    [Show full text]
  • The Psychophysics of Consciousness: a Hypothesis
    S.R. Joye The Psychophysics of Consciousness The Psychophysics of Consciousness: A Hypothesis "Hypothesis: a very poor choice of word to designate the supreme spiritual act by which the dust-cloud of experience takes on form and is kindled at the fire of knowledge." Pierre Teilhard de Chardin August 9, 2013 S.R. Joye, B.S. Electrical Engineering, M.A. Asian Philosophy, CIIS Doctoral Candidate, Department of Philosophy & Religion Concentration in Philosophy, Cosmology, and Consciousness PARP 9600 – Doctoral Comprehensive Exam Paper Professor Allan Combs School of Consciousness and Transformation Summer Semester 2013 Comp. Exam Part II The Psychophysics of Consciousness The Psychophysics of Consciousness: A Hypothesis Abstract Gustav Fechner, the German experimental psychologist, coined the term psychophysics in 1860, publishing the first mathematical equation to model human consciousness.1 Fechner assumed that any future approaches to consciousness would include mathematical and physical underpinnings. In 1995, the cognitive scientist and philosopher David Chalmers coined the phrase "the hard problem" as being that of connecting consciousness with some physical substrate. According to Chalmers, "The really hard problem of consciousness is the problem of experience. Most existing theories of consciousness either deny the phenomenon, explain something else, or elevate the problem to an eternal mystery."2 As Chalmers points out, unfortunately, the modern scientific community has not yet produced a model of consciousness supported by mathematics and physics, thus no progress in Fecher's "psychophysics." However there is growing interest among the scientific community in string theory, the only branch of mathematical geometry that has successfully explained recent discoveries in high energy particle physics.
    [Show full text]
  • Empfindungsfähigkeit Und Moralischer Status Eine Kritik Der Pathozentrischen Ethik
    Empfindungsfähigkeit und moralischer Status Eine Kritik der pathozentrischen Ethik Inauguraldissertation zur Erlangung des Doktorgrades der Philosophie im Fachbereich A Geistes- und Kulturwissenschaften der Bergischen Universität Wuppertal vorgelegt von Erasmus Scheuer aus Düsseldorf Wuppertal, im Januar 2018 Die Dissertation kann wie folgt zitiert werden: urn:nbn:de:hbz:468-20180503-133904-3 [http://nbn-resolving.de/urn/resolver.pl?urn=urn%3Anbn%3Ade%3Ahbz% 3A468-20180503-133904-3] alles bleibt wie es ist Geheimnis in einem Geheimnis Muster in einem Muster (Norbert Scheuer – Nichts) Meinen Eltern, Elvira und Norbert Scheuer Vorwort Der Pathozentrismus betrachtet die Leidens- oder Empfindungsfähigkeit aller, auch nichtmenschlicher Spezies als zentrales moralisches Kriterium. Diese Arbeit hat die pathozentrische Position zum Gegenstand und bewegt sich bewusst zwischen Kritik und Verteidigung eines solchen Ansatzes. Einerseits liegen die Schwächen des Pa- thozentrismus m.E. mehr oder weniger offen zu Tage, da die Kluft zwischen Empfin- dungen des Menschen und den Empfindungen anderer Spezies nur schwer inner- halb eines naturwissenschaftlich-physikalistischen Weltbildes überbrückbar erscheint. Andererseits vertrete ich als Verfasser dieser Arbeit die Ansicht, dass eine Erweiterung der Moralobjekte über die Menschen hinaus erfolgen muss, dass das Leiden anderer Kreaturen Teil einer jeden ethischen Betrachtung sein sollte. Der Pa- thozentrismus vertritt mit seinem Kriterium der Leidens- bzw. Empfindungsfähigkeit eine ethische Position, die vom Ansatz her eine Erweiterung der Moralobjekte an- strebt. Aus diesem Grund liegt meine Sympathie beim Pathozentristen. Infolgedes- sen versucht diese Arbeit, einerseits die Kritik am Pathozentrismus aufzuzeigen, an- dererseits dem Pathozentristen auch Argumente an die Hand zu geben, die es ihm erlauben, seine Position zu verteidigen. Der Pathozentrist hat nach meiner Ansicht zwei schwerwiegende und grundlegende Probleme, wenn er seine Ethik innerhalb eines tendenziell physikalistischen Weltbildes zu verteidigen sucht.
    [Show full text]
  • Weber-Fechner Law Forrest W
    Plant Pathology and Microbiology Publications Plant Pathology and Microbiology 7-2010 Weber-Fechner Law Forrest W. Nutter Jr. Iowa State University, [email protected] Follow this and additional works at: http://lib.dr.iastate.edu/plantpath_pubs Part of the Agricultural Science Commons, Agriculture Commons, and the Plant Pathology Commons The ompc lete bibliographic information for this item can be found at http://lib.dr.iastate.edu/ plantpath_pubs/71. For information on how to cite this item, please visit http://lib.dr.iastate.edu/ howtocite.html. This Book Chapter is brought to you for free and open access by the Plant Pathology and Microbiology at Iowa State University Digital Repository. It has been accepted for inclusion in Plant Pathology and Microbiology Publications by an authorized administrator of Iowa State University Digital Repository. For more information, please contact [email protected]. Weber-Fechner Law Abstract Several models have been proposed in the field of psychophysics to quantify relationships between any stimulus (e.g., touch, sound, light, and smell) and the perceived response by individuals. One such model is referred to as the Weber-Fechner Law. The eW ber −Fechner Law, however, is not one law, but two separate laws: Weber's Law and Fechner's Law. Moreover, not all human senses respond to stimuli according to Fechner's law (in fact many do not). Weber's Law and special cases such as Fechner's Law are each based on the “just noticeable difference threshold” concept. Disciplines Agricultural Science | Agriculture | Plant Pathology Comments This chapter is from Encyclopedia of Research Design (2010): 1612, doi:10.4135/9781412961288.n494.
    [Show full text]
  • Chapter 4 – Wilhelm Wundt and the Founding of Psychology
    CHAPTER 6 – GERMAN PSYCHOLOGISTS OF THE 19TH & EARLY 20TH CENTURIES Dr. Nancy Alvarado German Rivals to Wundt Ernst Weber & Gustav Fechner -- psychophysicists Hermann Ebbinghaus -- memory Franz Brentano Carl Stumpf Oswald Kulpe Weber & Fechner Ernst Weber (1795-1878) Weber published “De tactu” describing the minimum amount of tactile stimulation needed to experience a sensation of touch – the absolute threshold. Using weights he found that holding versus lifting them gave different results (due to muscles involved). He used a tactile compass to study how two-point discrimination varied across the body. On the fingertip .22 cm, on the lips .30 cm, on the back 4.06 cm. Just Noticeable Difference (JND) Weber studied how much a stimulus must change in order for a person to sense the change. How much heavier must a weight be in order for a person to notice that it is heavier? This amount is called the just noticeable difference JND The JND is not fixed but varies with the size of the weights being compared. R k JND can be expressed as a ratio: R where R is stimulus magnitude and k is a constant and R means the change in R ( usually means change) Gustav Fechner (1801-1887) Fechner related the physical and psychological worlds using mathematics. Fechner (1860) said: “Psychophysics, already related to physics by name must on one hand be based on psychology, and [on] the other hand promises to give psychology a mathematical foundation.” (pp. 9-10) Fechner extended Weber’s work because it provided the right model for accomplishing this. Fechner’s Contribution Fechner called Weber’s finding about the JND “Weber’s Law.” Fechner’s formula describes how the sensation is related to increases in stimulus size: S k log R where S is sensation, k is Weber’s constant and R is the magnitude of a stimulus The larger the stimulus magnitude, the greater the amount of difference needed to produce a JND.
    [Show full text]
  • Lecture 1 Intro
    1 Introduction Chapter 1 Introduction • Welcome to Our World • Thresholds and the Dawn of Psychophysics • Sensory Neuroscience and the Biology of Perception Introduction What do we mean by “Sensation & Perception?” • Sensation: The ability to detect a stimulus and, perhaps, to turn that detection into a private experience. • Perception: The act of giving meaning to a detected sensation. Sensation and perception are central to mental life. • Without them, how would we gain knowledge of the world? Introduction Psychologists typically study sensation and perception. • Also studied by biologists, computer scientists, medical doctors, neuroscientists, and many other fields Introduction The study of sensation and perception is a scientific pursuit and requires scientific methods. • Thresholds: Finding the limits of what can be perceived. • Scaling: Measuring private experience. • Signal detection theory: Measuring difficult decisions. • Sensory neuroscience: The biology of sensation and perception. • Neuroimaging: An image of the mind. Thresholds and the Dawn of Psychophysics Gustav Fechner (1801–1887) invented “psychophysics” and is often considered to be the true founder of experimental psychology. Fechner was an ambitious and hard- working young man who worked himself to the point of exhaustion. • Damaged his eyes by staring at the sun while performing vision experiments Figure 1.3 Gustav Fechner invented psychophysics and is thought by some to be the true founder of experimental psychology Thresholds and the Dawn of Psychophysics Fechner thought about the philosophical relationship between mind and matter. • Dualism: The mind has an existence separate from the material world of the body. • Materialism: The only thing that exists is matter, and that all things, including mind and consciousness, are the results of interactions between bits of matter.
    [Show full text]
  • History of Psychology Documentation Release 0.1
    History of Psychology Documentation Release 0.1 Britt Anderson (and others) Dec 16, 2019 Contents 1 Preface 3 1.1 1 A meandering introduction.......................................3 1.1.1 1.1 Some technical comments.................................4 2 What is Psychology? 7 2.1 1 What is psychology?..........................................7 2.1.1 1.1 Aristotle...........................................8 2.1.2 1.2 John Stuart Mill.......................................8 2.1.3 1.3 Wilhelm Wundt.......................................8 2.1.4 1.4 Edward Bradford Titchener.................................8 2.1.5 1.5 William James.......................................8 2.1.6 1.6 John Watson.........................................8 2.1.7 1.7 George Trumball Ladd and Robert Sessions Woodworth.................8 2.1.8 1.8 David G. Myers.......................................9 2.2 2 What’s in a name?...........................................9 2.3 3 Some comments............................................9 2.4 4 A Few Final Questions.........................................9 3 Philosophical Antecedents 11 3.1 1 Where to begin?............................................ 12 3.2 2 Philosophers and Psychology..................................... 12 3.2.1 2.1 Descartes (1596 - 1650)................................... 12 3.2.2 2.2 John Locke (1632 - 1704).................................. 16 3.2.3 2.3 Other names - Other stories................................. 18 3.2.4 2.4 Question for Review, Discussion, and a Scavanger Hunt.................. 20 4
    [Show full text]
  • Sensation & Perception, 4E
    1 Introduction Chapter 1 Introduction • Thresholds and the Dawn of Psychophysics • Sensory Neuroscience and the Biology of Perception Introduction What do we mean by “Sensation & Perception?” • Sensation: The ability to detect a stimulus (convert to nervous system activity) • Perception: The act of giving meaning to a detected sensation. (Schieber say “integration” “objects”) • Cognition: The manipulation of perceptual objects (in the service of goals) Sensory processes are not available to consciousness but the products of perceptual processes are the objects of awareness Introduction Sensation and perception are central to mental life. • Without them, how would we gain knowledge of the world? Introduction The study of sensation and perception is a scientific pursuit and requires scientific methods. • Thresholds: Finding the limits of what can be perceived. • Scaling: Measuring private experience. • Signal detection theory: Measuring difficult decisions. • Sensory neuroscience: The biology of sensation and perception. • Neuroimaging: An image of the mind. Thresholds and the Dawn of Psychophysics Psychophysical Thresholds Thresholds and the Dawn of Psychophysics First, some formal definitions: • Just noticeable difference (JND): The smallest detectable difference between two stimuli, or the minimum change in a stimulus that can be correctly judged as different from a reference stimulus; also known as difference threshold. • Absolute threshold: Minimum amount of stimulation necessary for a person to detect a stimulus 50% of the time. The Concept of Absolute Threshold Ideal Absolute Threshold The Concept of Absolute Threshold But…. early experimental psychologists like Fechner discovered that humans were not ideal observers. Instead, behavior at the boundary of sensory sensitivity appeared to reflect probabilistic processes rather than ideal detection.
    [Show full text]
  • Changing the Cartesian Mind: Leibniz on Sensation, Representation and Consciousness
    Penultimate draft. Final draft in The Philosophical Review, 110, no. 1 (January, 2001). Reprinted in The Philosopher’s Annual XXIV, 2002. Changing the Cartesian Mind: Leibniz on Sensation, Representation and Consciousness Alison Simmons What did Leibniz have to contribute to the philosophy of mind? To judge from textbooks in the philosophy of mind, and even Leibniz commentaries, the answer is: not much. That may be because Leibniz’s philosophy of mind looks roughly like a Cartesian philosophy of mind. Like Descartes and his followers, Leibniz claims that the mind is immaterial and immortal; that it is a thinking thing (and is never not thinking); that it is a different kind of thing from body and obeys its own laws; and that it comes stocked with innate truth-tracking intellectual ideas and an epistemically troubling habit of forming confused sensory ideas on the occasion of external corporeal events. Nothing is new. Of course, Leibniz adds unconscious perceptions to the mind in the form of his famous petites perceptions and he offers a unique solution to the problem of mind-body interaction in the form of his infamous pre- established harmony. In the overall scheme of things, however, these look like minor alterations in a philosophy of mind that the Cartesians had been advocating for some fifty years. Or so it appears. Leibniz is not, in fact, a Cartesian philosopher of mind. In the opening of the New Essays on Human Understanding, his spokesman announces in no uncertain terms: “I should tell you the news that I am no longer a Cartesian” (NE I.i, A/RB 71).1 The list of theses that he presents to illustrate his renunciation of Cartesianism is dominated by issues in the philosophy of mind.
    [Show full text]
  • Consciousness Science Underdetermined: a Short History of Endless Debates
    AN OPEN ACCESS Ergo JOURNAL OF PHILOSOPHY Consciousness Science Underdetermined: A Short History of Endless Debates MATTHIAS MICHEL Sciences, Normes et Démocratie, Sorbonne Université, CNRS. Consciousness scientists have not reached consensus on two of the most central questions in their field: first, on whether consciousness overflows reportability; sec- ond, on the physical basis of consciousness. I review the scientific literature of the 19th century to provide evidence that disagreement on these questions has been a feature of the scientific study of consciousness for a long time. Based on this his- torical review, I hypothesize that a unifying explanation of disagreement on these questions, up to this day, is that scientific theories of consciousness are underde- termined by the evidence, namely, that they can be preserved “come what may” in front of (seemingly) disconfirming evidence. Consciousness scientists may have to find a way of solving the persistent underdetermination of theories of consciousness to make further progress. cientists studying consciousness have been unable to settle two central de- Sbates in the field. The first is about whether subjects are conscious of more than they can report: some researchers believe that consciousness and report- ability are equivalent (Dehaene & Changeux 2011; Naccache 2018), while others think that consciousness overflows reportability (Block 1995; 2007; Lamme 2010). The second debate is about the identification of the physical basis of conscious- ness (e.g., Boly, Massimini, Tsuchiya, Postle, Koch, & Tononi, 2017; Odegaard et. al. 2017). In this debate, theories according to which consciousness pervades the universe co-exist with theories suggesting that some specific parts of the cortex are responsible for consciousness (Dehaene, Charles, King, & Marti 2014; Tononi & Koch 2015).
    [Show full text]
  • The Conception of Belief in Gustav Fechner
    THE CONCEPTION OF BELIEF IN GUSTAV FECHNER AND WILLIAM JAMES (THE UNWRITTEN CHAPTER OF THE VARIETIES OF RELIGIOUS EXPERIENCE) NIKOLAI IVANOV E-MAIL: [email protected] ABSTRACT: The current paper deals with the relation between William James’s and Gustav Fechner’s philosophical theorizing in the field of religion. The both philosophers aspire to justify faith in narrow and wide sense through rational and pragmatist arguments. While Fechner’s argumentation rests upon his ontology, James employs a strategy for defending religious belief on the grounds of religious experience. Gustav Fechner’s conception of belief is based on important principles of the Daylight-view, like continuity and analogy. This fact does not mean that Fechner’s personal over-beliefs influenced completely his account of belief, for die Tagesansicht is essentially an ontology, and not a system consisting of personal values. Despite the similarities found between the both philosophers, it is clear that Fechner was not a predecessor of pragmatism. James adopted only some of the cardinal points of Fechner’s panpsychist ontology. Nonetheless, he applied its principles to his own analysis of religious experience. KEY WORDS: pragmatism, panpsychism, pluralism, monism, belief, ontology 1. Introduction One of the few issues which have rarely been researched by James’s scholars is the influence exerted by the famous scientist and philosopher Gustav Theodor Fechner over the pragmatist. Despite his opposition to ontological monism, and in spite of his harsh criticism of Elements of psychophysics, James had a deep respect for the panpsychist metaphysics of Fechner, dedicating it a long chapter in A Pluralistic Universe, as well as in some of his letters.
    [Show full text]
  • When Bodies Think: Panpsychism, Pluralism, Biopolitics Martin Savransky (Goldsmiths, University of London) [email protected]
    When Bodies Think: Panpsychism, Pluralism, Biopolitics Martin Savransky (Goldsmiths, University of London) [email protected] Abstract Cultivating a speculative orientation to the medical humanities, the aim of this essay is to explore some dimensions of the recent calls for more participatory forms of medicine and healthcare under the sign of what, after Michel Foucault, I call the “biopolitical problematic”. That is, the divergent encounter between techniques of biopower that seek to take hold of life and the body, and a plurality of living bodies that persistently respond, challenge, and escape its grasp. If critics of “participatory medicine” have warned that the turn to “participation” in healthcare functions as a form of biopower that seeks to gain access to bodies, and in so doing take a better hold of life, in this essay I propose we experiment with the question of what kinds of conceptual tools may be required to make perceptible the ways in which a plurality of participating bodies may become capable of responding, challenging and escaping “participation’s” grasp. After problematising the ontology of participation involved in contemporary debates around participatory medicine, I draw on the work of William James and Alfred North Whitehead, among others, to argue for the need to reclaim a pluralistic panpsychism –in short, the proposition that all things think– as a pragmatic tool to envisage the possibility of a plurality of thinking bodies capable of unruly forms of participation that respond, challenge and escape biopower’s grasp. Introduction: A Biopolitical Problematic “[I]t was the taking charge of life, more than the threat of death, that gave power its access even to the body.” (1).
    [Show full text]