Changing the Cartesian Mind: Leibniz on Sensation, Representation and Consciousness
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Block.What.Psch.States.Not.1972.Pdf
Philosophical Review What Psychological States are Not Author(s): N. J. Block and J. A. Fodor Source: The Philosophical Review, Vol. 81, No. 2 (Apr., 1972), pp. 159-181 Published by: Duke University Press on behalf of Philosophical Review Stable URL: http://www.jstor.org/stable/2183991 Accessed: 08/09/2009 16:04 Your use of the JSTOR archive indicates your acceptance of JSTOR's Terms and Conditions of Use, available at http://www.jstor.org/page/info/about/policies/terms.jsp. JSTOR's Terms and Conditions of Use provides, in part, that unless you have obtained prior permission, you may not download an entire issue of a journal or multiple copies of articles, and you may use content in the JSTOR archive only for your personal, non-commercial use. Please contact the publisher regarding any further use of this work. Publisher contact information may be obtained at http://www.jstor.org/action/showPublisher?publisherCode=duke. Each copy of any part of a JSTOR transmission must contain the same copyright notice that appears on the screen or printed page of such transmission. JSTOR is a not-for-profit organization founded in 1995 to build trusted digital archives for scholarship. We work with the scholarly community to preserve their work and the materials they rely upon, and to build a common research platform that promotes the discovery and use of these resources. For more information about JSTOR, please contact [email protected]. Duke University Press and Philosophical Review are collaborating with JSTOR to digitize, preserve and extend access to The Philosophical Review. -
Chapter 7 Mental Representation Mental Representation
Chapter 7 Mental Representation Mental Representation Mental representation is a systematic correspondence between some element of a target domain and some element of a modeling (or representation) domain. A representation, whether it be mental or any other, is a system of symbols. The system of symbols is isomorphic to another system (the represented system) so that conclusions drawn through the processing of the symbols in the representing system constitute valid inferences about the represented system. Isomorphic means `having the same form.' The following figure is a typical example of how we represent information mentally in our minds. Figure 8.12 A hierarchical network representation of concepts. Source: Collins and Quillian (1969) The cognitive psychologists have always agreed on the fact that human information processing depends on the mental representation of information; but there is a great disagreement with regard to the nature of this mental representation of information. Symbols are the representations that are amodal. They bear no necessary resemblance to the concept or percept they represent. The systematic correspondence between the two domains may be a matter of convention (only). For example, in algebra, we denote the different variables as x, y, z, and so on, but neither of these symbols have a direct resemblance to what they represent. Similarly, while solving a geometrical problem involving geometrical shapes, we might assign symbols such as A, B, or C to such geometrical shapes, even though these symbols do not have a direct resemblance to the shapes. Images are another way how the information can be represented in our minds. Images are basically representations that resemble what they represent in some non-arbitrary way. -
Magic, Semantics, and Putnam's Vat Brains
Published in Studies in History and Philosophy of Science (««) t: [email protected] ;–tE. doi:10.1016/j.shpsc.2004.03.007 Magic, semantics, and Putnam’s vat brains Mark Sprevak Christina McLeish University of Edinburgh University of Cambridge Ït March «« In this paper we oòer an exegesis of Hilary Putnam’s classic argument against the brain-in-a-vat hypothesis oòered in his Reason, Truth and History (ÏÊÏ). In it, Putnam argues that we cannot be brains in a vat because the semantics of the situation make it incoherent for anyone to wonder whether they are a brain a vat.Putnam’s argument is that in order for ‘I am a brain in a vat’ to be true, the person uttering it would have to be able to refer successfully to those things: the vat, and the envatted brain. Putnam thinks that reference can’t be secured without relevant kinds of causal relations, which, if envatted, the brain would lack, and so, it fails to be able to meaningfully utter ‘I am a brain in a vat’. We consider the implications of Putnam’s arguments for the traditional sceptic. In conclusion, we discuss the role of Putnam’s arguments against the brain in a vat hypothesis in his larger defense of his own internal realism against metaphysical realism. Ï Introduction Consider the possibility, familiar to us in many guises, that instead of being a living breathing human, you are a brain in a vat. Almost everything that you believe about the external world is false. Your body, your friends, your family, your home—none of these things exist. -
Erica Fretwell SENSORY EXPERIMENTS Sensory Experiments PSYCHOPHYSICS, RACE, and the AESTHETICS of FEELING
S E N S O R Y E X P E R I M E N T S Psychophysics, RACE, and the Aesthetics of feeling Erica Fretwell SENSORY EXPERIMENTS Sensory Experiments PSYCHOPHYSICS, RACE, AND THE AESTHETICS OF FEELING Erica Fretwell Duke University Press Durham and London 2020 © 2020 Duke University Press All rights reserved Printed in the United States of Amer i ca on acid- free paper ∞ Designed by Amy Ruth Buchanan Typeset in Arno and Avenir by Westchester Publishing Services Library of Congress Cataloging- in- Publication Data Names: Fretwell, Erica, [date] author. Title: Sensory experiments : psychophysics, race, and the aesthetics of feeling / Erica Fretwell. Description: Durham : Duke University Press, 2020. | Includes bibliographical references and index. Identifiers:lccn 2019054741 (print) | lccn 2019054742 (ebook) | isbn 9781478009863 (hardcover) | isbn 9781478010937 (paperback) | isbn 9781478012450 (ebook) Subjects: lcsh: Psychophysics. | Senses and sensation— Social aspects. | Racism—United States—Psychological aspects. | Racism—United States—History—19th century. | Science—Social aspects—United States—History—19th century. Classification:lcc bf237 .f74 2020 (print) | lcc bf237 (ebook) | ddc 152.10973/09034—dc23 lc record available at https://lccn.loc.gov/2019054741 lc ebook record available at https://lccn.loc.gov/2019054742 Duke University Press gratefully acknowl- edges the University at Albany, SUNY, which provided funds toward the publication of this book. IN MEMORY OF STEVEN FRETWELL CONTENTS Acknowl edgments ix Introduction: NEW SENSATION 1 -
The Psychophysics of Consciousness: a Hypothesis
S.R. Joye The Psychophysics of Consciousness The Psychophysics of Consciousness: A Hypothesis "Hypothesis: a very poor choice of word to designate the supreme spiritual act by which the dust-cloud of experience takes on form and is kindled at the fire of knowledge." Pierre Teilhard de Chardin August 9, 2013 S.R. Joye, B.S. Electrical Engineering, M.A. Asian Philosophy, CIIS Doctoral Candidate, Department of Philosophy & Religion Concentration in Philosophy, Cosmology, and Consciousness PARP 9600 – Doctoral Comprehensive Exam Paper Professor Allan Combs School of Consciousness and Transformation Summer Semester 2013 Comp. Exam Part II The Psychophysics of Consciousness The Psychophysics of Consciousness: A Hypothesis Abstract Gustav Fechner, the German experimental psychologist, coined the term psychophysics in 1860, publishing the first mathematical equation to model human consciousness.1 Fechner assumed that any future approaches to consciousness would include mathematical and physical underpinnings. In 1995, the cognitive scientist and philosopher David Chalmers coined the phrase "the hard problem" as being that of connecting consciousness with some physical substrate. According to Chalmers, "The really hard problem of consciousness is the problem of experience. Most existing theories of consciousness either deny the phenomenon, explain something else, or elevate the problem to an eternal mystery."2 As Chalmers points out, unfortunately, the modern scientific community has not yet produced a model of consciousness supported by mathematics and physics, thus no progress in Fecher's "psychophysics." However there is growing interest among the scientific community in string theory, the only branch of mathematical geometry that has successfully explained recent discoveries in high energy particle physics. -
Perception and Representation in Leibniz
PERCEPTION AND REPRESENTATION IN LEIBNIZ by Stephen Montague Puryear B.S., Mechanical Engineering, North Carolina State University, 1994 M.A., Philosophy, Texas A&M University, 2000 M.A., Philosophy, University of Pittsburgh, 2004 Submitted to the Graduate Faculty of the Department of Philosophy in partial fulfillment of the requirements for the degree of Doctor of Philosophy University of Pittsburgh 2006 UNIVERSITY OF PITTSBURGH DEPARTMENT OF PHILOSOPHY This dissertation was presented by Stephen Montague Puryear It was defended on December 5, 2005 and approved by Nicholas Rescher University Professor of Philosophy Robert B. Brandom Distinguished Service Professor of Philosophy Stephen Engstrom Associate Professor of Philosophy J. E. McGuire Professor of History and Philosophy of Science Dissertation Director: Nicholas Rescher University Professor of Philosophy ii Copyright °c by Stephen Montague Puryear 2006 iii PERCEPTION AND REPRESENTATION IN LEIBNIZ Stephen Montague Puryear, Ph.D. University of Pittsburgh, 2006 Though Leibniz’s views about perception and representation go to the heart of his philosophy, they have received surprisingly little attention over the years and in many ways continue to be poorly understood. I aim to redress these shortcomings. The body of the work begins with an exploration of Leibniz’s proposed analysis of representation (Chapter 2). Here I argue that on this analysis representation consists in a kind of structural correspondence— roughly an isomorphism—between representation and thing represented. Special attention is given to the application of this analysis to the challenging cases of linguistic and mental representation. The next two chapters concern what I take to be the central issue of the work: the nature of distinct perception. -
Ideas and Confusion in Leibniz 1
This article was downloaded by: [Stanford University Libraries] On: 24 September 2012, At: 17:23 Publisher: Routledge Informa Ltd Registered in England and Wales Registered Number: 1072954 Registered office: Mortimer House, 37-41 Mortimer Street, London W1T 3JH, UK British Journal for the History of Philosophy Publication details, including instructions for authors and subscription information: http://www.tandfonline.com/loi/rbjh20 Ideas and Confusion in Leibniz Shane Duarte a a Stanford University, Version of record first published: 22 Sep 2009. To cite this article: Shane Duarte (2009): Ideas and Confusion in Leibniz , British Journal for the History of Philosophy, 17:4, 705-733 To link to this article: http://dx.doi.org/10.1080/09608780903135089 PLEASE SCROLL DOWN FOR ARTICLE Full terms and conditions of use: http://www.tandfonline.com/page/terms- and-conditions This article may be used for research, teaching, and private study purposes. Any substantial or systematic reproduction, redistribution, reselling, loan, sub- licensing, systematic supply, or distribution in any form to anyone is expressly forbidden. The publisher does not give any warranty express or implied or make any representation that the contents will be complete or accurate or up to date. The accuracy of any instructions, formulae, and drug doses should be independently verified with primary sources. The publisher shall not be liable for any loss, actions, claims, proceedings, demand, or costs or damages whatsoever or howsoever caused arising directly or indirectly in connection with or arising out of the use of this material. British Journal for the History of Philosophy 17(4) 2009: 705–733 ARTICLE IDEAS AND CONFUSION IN LEIBNIZ1 Shane Duarte I. -
Information and Mental Representation †
Proceedings Information and Mental Representation † Wei Jiang School of Marxism, Xi’an University of Architecture and Technology, Xi’an 710055, China; [email protected] † Presented at the Fourth International Conference on Philosophy of Information, Berkeley, CA, USA, 2–6 June 2019. Published: 11 June 2020 Abstract: Information has been used to explain mental representation. However, whether it succeeds in explaining the mentality of mental representation is an issue. In my view, although there are some advantages of this approach, mental representation cannot be reduced to informational processes for two reasons. First, informational processes cannot cover the distinctively subjective feature of mental representation, Second, informational processes cannot characterize the semantic properties of mental representation. Furthermore, I have some doubts regarding the intelligence of AI based on the problems of the informational approach to mental representation. Keywords: information; mental representation; semantic 1. Introduction Informational processes have been considered as a common way to explain mental representation. However, whether it is able to go further to cover the special features of mental representation, apart from explaining the underlying process, is still an issue. I stand for a negative point of view that the informational approach is not a successful and complete approach to explain mental representation, which probably thereafter sheds light on the non-intelligence of AI. 2. Background Mental representation has been one of the central issues in the philosophy of the mind. It refers to mental phenomena that have mental content. There are many examples of mental representation in our daily life, such as mental pictures, perception, belief, desire, imagination, memory, and so on. -
Empfindungsfähigkeit Und Moralischer Status Eine Kritik Der Pathozentrischen Ethik
Empfindungsfähigkeit und moralischer Status Eine Kritik der pathozentrischen Ethik Inauguraldissertation zur Erlangung des Doktorgrades der Philosophie im Fachbereich A Geistes- und Kulturwissenschaften der Bergischen Universität Wuppertal vorgelegt von Erasmus Scheuer aus Düsseldorf Wuppertal, im Januar 2018 Die Dissertation kann wie folgt zitiert werden: urn:nbn:de:hbz:468-20180503-133904-3 [http://nbn-resolving.de/urn/resolver.pl?urn=urn%3Anbn%3Ade%3Ahbz% 3A468-20180503-133904-3] alles bleibt wie es ist Geheimnis in einem Geheimnis Muster in einem Muster (Norbert Scheuer – Nichts) Meinen Eltern, Elvira und Norbert Scheuer Vorwort Der Pathozentrismus betrachtet die Leidens- oder Empfindungsfähigkeit aller, auch nichtmenschlicher Spezies als zentrales moralisches Kriterium. Diese Arbeit hat die pathozentrische Position zum Gegenstand und bewegt sich bewusst zwischen Kritik und Verteidigung eines solchen Ansatzes. Einerseits liegen die Schwächen des Pa- thozentrismus m.E. mehr oder weniger offen zu Tage, da die Kluft zwischen Empfin- dungen des Menschen und den Empfindungen anderer Spezies nur schwer inner- halb eines naturwissenschaftlich-physikalistischen Weltbildes überbrückbar erscheint. Andererseits vertrete ich als Verfasser dieser Arbeit die Ansicht, dass eine Erweiterung der Moralobjekte über die Menschen hinaus erfolgen muss, dass das Leiden anderer Kreaturen Teil einer jeden ethischen Betrachtung sein sollte. Der Pa- thozentrismus vertritt mit seinem Kriterium der Leidens- bzw. Empfindungsfähigkeit eine ethische Position, die vom Ansatz her eine Erweiterung der Moralobjekte an- strebt. Aus diesem Grund liegt meine Sympathie beim Pathozentristen. Infolgedes- sen versucht diese Arbeit, einerseits die Kritik am Pathozentrismus aufzuzeigen, an- dererseits dem Pathozentristen auch Argumente an die Hand zu geben, die es ihm erlauben, seine Position zu verteidigen. Der Pathozentrist hat nach meiner Ansicht zwei schwerwiegende und grundlegende Probleme, wenn er seine Ethik innerhalb eines tendenziell physikalistischen Weltbildes zu verteidigen sucht. -
Weber-Fechner Law Forrest W
Plant Pathology and Microbiology Publications Plant Pathology and Microbiology 7-2010 Weber-Fechner Law Forrest W. Nutter Jr. Iowa State University, [email protected] Follow this and additional works at: http://lib.dr.iastate.edu/plantpath_pubs Part of the Agricultural Science Commons, Agriculture Commons, and the Plant Pathology Commons The ompc lete bibliographic information for this item can be found at http://lib.dr.iastate.edu/ plantpath_pubs/71. For information on how to cite this item, please visit http://lib.dr.iastate.edu/ howtocite.html. This Book Chapter is brought to you for free and open access by the Plant Pathology and Microbiology at Iowa State University Digital Repository. It has been accepted for inclusion in Plant Pathology and Microbiology Publications by an authorized administrator of Iowa State University Digital Repository. For more information, please contact [email protected]. Weber-Fechner Law Abstract Several models have been proposed in the field of psychophysics to quantify relationships between any stimulus (e.g., touch, sound, light, and smell) and the perceived response by individuals. One such model is referred to as the Weber-Fechner Law. The eW ber −Fechner Law, however, is not one law, but two separate laws: Weber's Law and Fechner's Law. Moreover, not all human senses respond to stimuli according to Fechner's law (in fact many do not). Weber's Law and special cases such as Fechner's Law are each based on the “just noticeable difference threshold” concept. Disciplines Agricultural Science | Agriculture | Plant Pathology Comments This chapter is from Encyclopedia of Research Design (2010): 1612, doi:10.4135/9781412961288.n494. -
Introduction
Introduction At least four assumptions appear to be part of the common ground of inter pretation among scholars of Ockham. The first can be described as a kind of general methodological presupposition, in that it has become standard to explore the Franciscan as a potential contributor to current philosophical debates, such as the issue of externalism in the philosophy of language and in the philosophy of mind.1 The view that medieval philosophers – or at least, Ockham – are of interest only to historians and theologians does not enjoy great popularity, especially not among philosophers working in the tradition of analytic philosophy.2 Second, Ockham is usually labelled a nominalist. While nominalism is not a single unified position,3 Ockham can be called a nominalist insofar as he sub scribes to the view that there are only particular things in this world: he admits only of two kinds of things in his ontology, namely particular substances (Socrates, this apple) and particularized qualities (the wisdom of Socrates, the redness of this apple).4 It would perhaps be more fitting to call Ockham’s posi tion ‘particularistic’. He thereby takes a conceptual stance on the problem of universals.5 According to Ockham, universals are nothing but concepts exist ing in the intellect. There is nothing universal ‘out there’ in the world. That a concept such as whale or wisdom is universal means that whale is semantically 1 See for instance Peter King, ‘Rethinking Representation in the Middle Ages’, in H. Lagerlund (ed.), Representation and Objects of Thought in Medieval Philosophy, Hampshire, 2007; Calvin Normore, ‘Burge, Descartes and Us’, in M. -
Michael Rescorla
February 9, 2020 Michael Rescorla Department of Philosophy University of California Los Angeles, CA 90095 [email protected] Employment Professor, Summer 2016 to present Department of Philosophy, University of California, Los Angeles Professor, Summer 2015 to Spring 2016 Department of Philosophy, University of California, Santa Barbara Associate Professor, Summer 2009 to Spring 2015 Department of Philosophy, University of California, Santa Barbara Assistant Professor, Fall 2003 to Spring 2009 Department of Philosophy, University of California, Santa Barbara Education Harvard University, Ph.D., Philosophy, June 2003 Dissertation: Is Thought Explanatorily Prior to Language? Harvard University, B.A., Summa Cum Laude, Philosophy and Mathematics, June 1997 Senior Thesis: Forcing, Atoms, and Choice Published Papers “Reifying Representations,” What Are Mental Representations?, eds. Joulia Smorthchkova, Tobias Schlicht, and Krzysztof Dolega. Oxford: Oxford University Press (forthcoming). “An Improved Dutch Book Theorem for Conditionalization,” Erkenntnis (published on-line; print version forthcoming). “On the Proper Formulation of Conditionalization,” Synthese (published on-line; print version forthcoming). “How Particular Is Perception?”. Philosophy and Phenomenological Research 100 (2020): pp. 721- 727. (Contribution to a book symposium on Susanna Schellenberg’s The Unity of Perception.) “Perceptual Co-Reference,” The Review of Philosophy and Psychology (published on-line; print version forthcoming). “A Realist Perspective on Bayesian Cognitive Science,” Inference and Consciousness, eds. Anders Nes and Timothy Chan. Routledge (2020): pp. 40-73. “A Dutch Book Theorem and Converse Dutch Book Theorem for Kolmogorov Conditionalization,” The Review of Symbolic Logic 11 (2018): pp. 705-735. “Motor Computation,” The Routledge Handbook of the Computational Mind, eds. Matteo Colombo and Mark Sprevak. Routledge (2018): pp. 424-435.