DOCSLIB.ORG

Copyrighted Material

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text

Load more

Trim Size: 7.5in x 9.25in Goodwin ftoc.tex V1 - December 2, 2014 9:04 P.M. Page iii CONTENTS PREFACE ix Locke on Human Understanding 32 Locke on Education 34 George Berkeley (1685–1753): Empiricism Applied CHAPTER 1 INTRODUCING PSYCHOLOGY’S to Vision 35 HISTORY 1 British Associationism 37 Why Take This Course? 2 David Hume (1711–1776): The Rules of Why Study History? 2 Association 37 Why Study Psychology’s History? 4 David Hartley (1705–1757): A Physiological Key Issues in Psychology’s History 6 Associationism 39 Presentism versus Historicism 7 Close-Up: Raising a Philosopher 41 Internal versus External History 9 John Stuart Mill (1806–1873): On the Verge of Personalistic versus Naturalistic History 10 Psychological Science 42 Close-Up: Edwin G. Boring (1886–1968) 10 Mill’s Psychology 43 This Book’s Point of View 13 Mill’s Logic 44 Historiography: Doing and Writing History 13 Rationalist Responses to Empiricism 45 Sources of Historical Data 14 Gottfried Wilhelm Leibniz (1646–1716) 45 From the Miles Papers: Miles Meets His Academic Immanuel Kant (1724–1804) 46 Grandfather 16 In Perspective: Philosophical Foundations 47 Problems with the Writing of History 17 Summary 48 Data Selection Problems 17 Study Questions 49 Interpretation Problems 19 Approaching Historical Truth 20 CHAPTER 3 THE SCIENTIFIC CONTEXT 50 Summary 21 Study Questions 22 Heroic Science in the Age of Enlightenment 51 Functioning of the Nervous System 52 Reflex Action 53 The Bell–Magendie Law 54 CHAPTER 2 THE PHILOSOPHICAL CONTEXT 24 The Specific Energies of Nerves 56 Helmholtz: The Physiologist’s Physiologist 57 A Long Past 25 Measuring the Speed of Neural Impulses 58 René Descartes (1596–1650): The Beginnings of Modern Helmholtz on Vision and Audition 59 Philosophy and Science COPYRIGHTED25 MATERIALHelmholtz and the Problem of Perception 61 Descartes and the Rationalist Argument 27 Localization of Brain Function 62 The Cartesian System 28 The Phrenology of Gall and Spurzheim 62 Descartes on the Reflex and Mind–Body Close-Up: The Marketing of Phrenology 65 Interaction 29 Flourens and the Method of Ablation 68 The British Empiricist Argument and the The Clinical Method 69 Associationists 32 The Remarkable Phineas Gage 70 John Locke (1632–1704): The Origins of British Broca and the Speech Center 71 Empiricism 32 Mapping the Brain: Electrical Stimulation 73 iii Trim Size: 7.5in x 9.25in Goodwin ftoc.tex V1 - December 2, 2014 9:04 P.M. Page iv iv CONTENTS Nervous System Structure 74 CHAPTER 5 DARWIN’S CENTURY: EVOLUTIONARY Neuron Theory 74 THINKING 110 Sir Charles Sherrington: The Synapse 76 From the Miles Papers: Miles Visits Sherrington in The Species Problem 111 Charles Darwin (1809–1882) and the Theory of Oxford 77 Evolution 112 In Perspective: The Nervous System and Behavior 78 The Shaping of a Naturalist 112 Summary 78 The Voyage of the Beagle 114 Study Questions 79 Darwin the Geologist 115 Darwin the Zoologist 115 CHAPTER 4 WUNDT AND GERMAN The Galapagos Islands 116 PSYCHOLOGY 81 The Evolution of Darwin’s Theory 116 An Education in Germany 82 Darwin’s Delay 118 On the Threshold of Experimental Psychology: Elements of the Theory of Evolution 120 Psychophysics 83 After the Origin of Species 121 Johann Herbart (1776–1841) 84 Darwin and Psychology’s History 122 Ernst Weber (1795–1878) 85 The Origins of Comparative Psychology 123 Two-Point Thresholds 85 Darwin on the Evolution of Emotional Weber’s Law 85 Expressions 123 Gustav Fechner (1801–1889) 86 Close-Up: Douglas Spalding and the Experimental Study of Fechner’s Elements of Psychophysics 87 Instinct 125 Wundt Establishes a New Psychology at Leipzig 88 George Romanes (1848–1894) and the Anecdotal Wilhelm Wundt (1832–1920): Creating a New Method 126 Science 88 Conwy Lloyd Morgan (1852–1936) and his Wundt’s Conception of the New Psychology 90 “Canon” 128 Studying Immediate Conscious Experience 91 Comparative Psychology in America 130 Studying Higher Mental Processes 92 Studying Individual Differences 130 Inside Wundt’s Laboratory 92 Francis Galton (1822–1911): Jack of All Sensation and Perception 92 Sciences 130 Mental Chronometry 93 The Nature of Intelligence 131 Close-Up: An American in Leipzig 95 The Anthropometric Laboratory 134 Rewriting History: The New and Improved Wilhelm Investigating Imagery and Association 134 Wundt 96 In Perspective: Darwin’s Century 136 The Source of the Problem 96 Summary 136 The Rediscovery of Wundt 97 Study Questions 137 The Real Wundt 97 The Wundtian Legacy 98 The New Psychology Spreads 99 CHAPTER 6 AMERICAN PIONEERS 139 Hermann Ebbinghaus (1850–1909): The Experimental Study of Memory 99 Psychology in 19th-Century America 140 The Ebbinghaus Forgetting Curve 102 Faculty Psychology 140 Other Contributions by Ebbinghaus 103 American Psychology’s First Textbook 141 G. E. Müller (1850–1934): The Experimentalist The Modern University 141 Prototype 103 Education for Women and Minorities 142 Oswald Külpe (1862–1915): The Würzburg William James (1842–1910): The First of the “New” School 104 Psychologists in America 146 Mental Sets and Imageless Thoughts 106 The Formative Years 147 In Perspective: A New Science 107 ALifeatHarvard 147 Summary 107 Creating American Psychology’s Most Famous Study Questions 108 Textbook 149 Trim Size: 7.5in x 9.25in Goodwin ftoc.tex V1 - December 2, 2014 9:04 P.M. Page v CONTENTS v On Methodology 150 From the Miles Papers: Miles and the Carlisle Consciousness 150 Conference 186 Habit 151 America’s Psychology: Functionalism 187 Emotion 152 The Chicago Functionalists 189 James’s Later Years 153 John Dewey (1859–1952): The Reflex Arc 189 Spiritualism 153 James R. Angell (1869–1949): The Province of Summing Up William James 154 Functional Psychology 191 G. Stanley Hall (1844–1924): Professionalizing the New Harvey Carr (1873–1954): The Maturing of Psychology 154 Functionalism 193 Hall’s Early Life and Education 155 The Columbia Functionalists 194 From Johns Hopkins to Clark 156 James McKeen Cattell (1860–1944): An Psychology at Clark 157 American Galton 194 Close-Up: Creating Maze Learning 158 Edward L. Thorndike (1874–1949): Cats in Hall and Developmental Psychology 160 Puzzle Boxes 197 Hall and Psychoanalysis 161 Robert S. Woodworth (1869–1962): A Dynamic From the Miles Papers: Miles and the Invention of the Psychology 202 Stylus Maze 163 In Perspective: Structuralism and Functionalism 204 Mary Whiton Calkins (1863–1930): Challenging the Male Summary 205 Monopoly 164 Study Questions 206 Calkins’s Life and Work 164 Graduate Education for Females 165 Calkins’s Research on Association 165 CHAPTER 8 APPLYING THE NEW From Psychology to Philosophy 166 PSYCHOLOGY 208 Other Women Pioneers: Untold Lives 167 The Desire for Application 209 Christine Ladd-Franklin (1847–1930) 167 From the Miles Papers: Miles and Stanford Football 210 Margaret Floy Washburn (1871–1939) 168 The Mental Testing Movement 212 Other Pioneers: Ladd and Baldwin 169 Alfred Binet (1857–1911): The Birth of Modern George Trumbull Ladd (1842–1921) 169 Intelligence Testing 212 James Mark Baldwin (1861–1934) 170 The Binet–Simon Scales 214 In Perspective: The New Psychology at the Henry H. Goddard (1866–1957): Binet’s Test Comes Millennium 171 to America 215 Summary 172 The Kallikaks 217 Study Questions 173 Goddard and the Immigrants 219 Lewis M. Terman (1877–1956): Institutionalizing IQ 221 CHAPTER 7 STRUCTURALISM AND The Stanford–Binet IQ Test 221 FUNCTIONALISM 175 Terman Studies the Gifted 222 Close-Up: Leta Hollingworth: Advocating for Gifted Titchener’s Psychology: Structuralism 176 Children and Debunking Myths about Women 224 From Oxford to Leipzig to Cornell 176 Robert M. Yerkes (1876–1956): The Army Testing Promoting Experimental Psychology at Cornell 177 Program 226 The Manuals 179 Army Alpha and Army Beta 227 The Experimentalists 181 The Controversy over Intelligence 230 Titchener’s Structuralist System 182 Applying Psychology to Business 232 Close-Up: The Introspective Habit 183 Hugo Münsterberg (1863–1916): The Diversity of The Structural Elements of Human Conscious Applied Psychology 233 Experience 184 Münsterberg and Employee Selection 235 Evaluating Titchener’s Contributions to Other Leading Industrial Psychologists in Psychology 185 America 237 Trim Size: 7.5in x 9.25in Goodwin ftoc.tex V1 - December 2, 2014 9:04 P.M. Page vi vi CONTENTS Walter Van Dyke Bingham (1880–1952) 237 Generalization and Differentiation 279 Lillian Moller Gilbreth (1878–1972) 238 Experimental Neurosis 279 Harry Hollingworth (1880–1956) 239 A Program of Research 280 Applied Psychology in Pavlov and the Soviets 280 Europe—Psychotechnics 240 Pavlov and the Americans 282 In Perspective: Applied Psychology 241 Close-Up: Misportraying Pavlov’s Apparatus 283 Summary 242 From the Miles Papers: Miles Meets Pavlov 284 Study Questions 243 John B. Watson and the Founding of Behaviorism 285 The Young Functionalist at Chicago 285 The Watson–Carr Maze Studies 286 CHAPTER 9 GESTALT PSYCHOLOGY 244 Opportunity Knocks at Johns Hopkins 288 The Origins and Early Development of Gestalt Watson and Animal Behavior 288 Watson’s Behaviorist Manifesto 289 Psychology 245 Max Wertheimer (1880–1943): Founding Gestalt Watson’s APA Presidential Address 291 Studying Emotional Development 291 Psychology 247 Koffka (1886–1941) and Köhler (1887–1967): The Zenith and the Nadir of a Career: Little Albert 292 Cofounders 249 A New Life in Advertising 295 Close-Up: A Case of Espionage? 251 Popularizing Behaviorism 296 Gestalt Psychology and Perception 252 Evaluating Watsonian Behaviorism 297 Principles of Perceptual Organization 253 In Perspective: Behaviorism’s Origins 299 Behavioral versus Geographic Environments 255 Summary 299 The Gestalt Approach to Cognition and Learning 255 Study Questions 300 Köhler on Insight in Apes 256 Wertheimer on Productive Thinking 257 Other Gestalt Research on Cognition 258 CHAPTER 11 THE EVOLUTION OF Kurt Lewin (1890–1947): Expanding the Gestalt BEHAVIORISM 302 Vision 260 Post-Watsonian Behaviorism 303 Early Life and Career 260 Logical Positivism and Operationism 304 From the Miles Papers: Miles Learns about the Nazi Neobehaviorism 306 Version of Academic Freedom 261 Edwin R.
Recommended publications
  • Placing Women in the History of Psychology the First American Women Psychologists

    Placing Women in the History of Psychology the First American Women Psychologists

    Placing Women in the History of Psychology The First American Women Psychologists Laurel Furumoto Wellesley College Elizabeth Scarborough State University of New York College at Fredonia ABSTRACT." This article presents an account of the first Traditional history has been written and interpreted by men in American women psychologists. The article provides data an androcentric frame of reference; it might quite properly be on the origins, education, marital status, and careers of described as the history of men. The very term "Women's His- the 22 women who identified themselves as psychologists tory" calls attention to the fact that something is missing from in the first edition of American Men of Science. Further, historical scholarship. (p. xiv) it explores how gender shaped their experience in relation Beyond calling attention to what is missing from the to educational and employment opportunities, responsi- history of psychology, this article begins to fill the gap by bilities to family, and the marriage versus career dilemma. sketching an overview of the lives and experiences of those Illustrations are drawn from the lives of Mary Whiton women who participated in the development of the dis- Calkins, Christine Ladd-Franklin, Margaret Floy Wash- cipline in the United States around the turn of the century. burn, and Ethel Puffer Howes. Sources used include ar- First, we identify early women psychologists. Second, we chival materials (manuscripts, correspondence, and insti- describe the women and note some comparisons between tutional records) as well as published literature. The article them and men psychologists. And last, we discuss wom- calls attention to the necessity of integrating women into en's experiences, focusing on how gender influenced their the history of the discipline if it is to provide an adequate careers.
  • Erica Fretwell SENSORY EXPERIMENTS Sensory Experiments PSYCHOPHYSICS, RACE, and the AESTHETICS of FEELING

    Erica Fretwell SENSORY EXPERIMENTS Sensory Experiments PSYCHOPHYSICS, RACE, and the AESTHETICS of FEELING

    S E N S O R Y E X P E R I M E N T S Psychophysics, RACE, and the Aesthetics of feeling Erica Fretwell SENSORY EXPERIMENTS Sensory Experiments PSYCHOPHYSICS, RACE, AND THE AESTHETICS OF FEELING Erica Fretwell Duke University Press Durham and London 2020 © 2020 Duke University Press All rights reserved Printed in the United States of Amer i ca on acid- free paper ∞ Designed by Amy Ruth Buchanan Typeset in Arno and Avenir by Westchester Publishing Services Library of Congress Cataloging- in- Publication Data Names: Fretwell, Erica, [date] author. Title: Sensory experiments : psychophysics, race, and the aesthetics of feeling / Erica Fretwell. Description: Durham : Duke University Press, 2020. | Includes bibliographical references and index. Identifiers:lccn 2019054741 (print) | lccn 2019054742 (ebook) | isbn 9781478009863 (hardcover) | isbn 9781478010937 (paperback) | isbn 9781478012450 (ebook) Subjects: lcsh: Psychophysics. | Senses and sensation— Social aspects. | Racism—United States—Psychological aspects. | Racism—United States—History—19th century. | Science—Social aspects—United States—History—19th century. Classification:lcc bf237 .f74 2020 (print) | lcc bf237 (ebook) | ddc 152.10973/09034—dc23 lc record available at https://lccn.loc.gov/2019054741 lc ebook record available at https://lccn.loc.gov/2019054742 Duke University Press gratefully acknowl- edges the University at Albany, SUNY, which provided funds toward the publication of this book. IN MEMORY OF STEVEN FRETWELL CONTENTS Acknowl edgments ​ix Introduction: NEW SENSATION 1
  • The Hiring of James Mark Baldwin and James Gibson Hume at Toronto in 1889

    The Hiring of James Mark Baldwin and James Gibson Hume at Toronto in 1889

    History of Psychology Copyright 2004 by the Educational Publishing Foundation 2004, Vol. 7, No. 2, 130–153 1093-4510/04/$12.00 DOI: 10.1037/1093-4510.7.2.130 THE HIRING OF JAMES MARK BALDWIN AND JAMES GIBSON HUME AT THE UNIVERSITY OF TORONTO IN 1889 Christopher D. Green York University In 1889, George Paxton Young, the University of Toronto’s philosophy professor, passed away suddenly while in the midst of a public debate over the merits of hiring Canadians in preference to American and British applicants for faculty positions. As a result, the process of replacing Young turned into a continuation of that argument, becoming quite vociferous and involving the popular press and the Ontario gov- ernment. This article examines the intellectual, political, and personal dynamics at work in the battle over Young’s replacement and its eventual resolution. The outcome would have an impact on both the Canadian intellectual scene and the development of experimental psychology in North America. In 1889 the University of Toronto was looking to hire a new professor of philosophy. The normally straightforward process of making a university appoint- ment, however, rapidly descended into an unseemly public battle involving not just university administrators, but also the highest levels of the Ontario govern- ment, the popular press, and the population of the city at large. The debate was not pitched solely, or even primarily, at the level of intellectual issues, but became intertwined with contentious popular questions of nationalism, religion, and the proper place of science in public education. The impact of the choice ultimately made would reverberate not only through the university and through Canada’s broader educational establishment for decades to come but, because it involved James Mark Baldwin—a man in the process of becoming one of the most prominent figures in the study of the mind—it also rippled through the nascent discipline of experimental psychology, just then gathering steam in the United States of America.
  • An Examination of Introductory Psychology Textbooks in America Randall D

    An Examination of Introductory Psychology Textbooks in America Randall D

    Ouachita Baptist University Scholarly Commons @ Ouachita Articles Faculty Publications 1992 Portraits of a Discipline: An Examination of Introductory Psychology Textbooks in America Randall D. Wight Ouachita Baptist University, [email protected] Wayne Weiten Follow this and additional works at: https://scholarlycommons.obu.edu/articles Part of the History of Science, Technology, and Medicine Commons, and the Psychology Commons Recommended Citation Weiten, W. & Wight, R. D. (1992). Portraits of a discipline: An examination of introductory psychology textbooks in America. In C. L. Brewer, A. Puente, & J. R. Matthews (Eds.), Teaching of psychology in America: A history (pp. 453-504). Washington DC: American Psychological Association. This Article is brought to you for free and open access by the Faculty Publications at Scholarly Commons @ Ouachita. It has been accepted for inclusion in Articles by an authorized administrator of Scholarly Commons @ Ouachita. For more information, please contact [email protected]. 20 PORTRAITS OF A DISCIPLINE: AN EXAMINATION OF INTRODUCTORY PSYCHOLOGY TEXTBOOKS IN AMERICA WAYNE WEITEN AND RANDALL D. WIGHT The time has gone by when any one person could hope to write an adequate textbook of psychology. The science has now so many branches, so many methods, so many fields of application, and such an immense mass of data of observation is now on record, that no one person can hope to have the necessary familiarity with the whole. -An author of an introductory psychology text If we compare general psychology textbooks of today with those of from ten to twenty years ago we note an undeniable trend toward amelio- We are indebted to several people who provided helpful information in responding to our survey discussed in the second half of the chapter, including Solomon Diamond for calling attention to Samuel Johnson and Noah Porter, Ernest R.
  • George Trumbull Ladd (1842-1921)

    George Trumbull Ladd (1842-1921)

    The International Journal of Indian Psychology ISSN 2348-5396 (e) | ISSN: 2349-3429 (p) Volume 6, Issue 4, DIP 18.01.001/20180604 DOI: 10.25215/0604.001 http://www.ijip.in | October - December, 2018 TimeLine Person of the Month: George Trumbull Ladd (1842-1921) Ankit Patel1* Born January 19, 1842 Painesville, Lake County, Ohio, US Died August 8, 1921 (aged 79) New Haven, Connecticut, US Citizenship American Known for The Principles of Church Polity (1882), What is the Bible? (1888), Philosophy of Knowledge (1897) Education Western Reserve College Andover Theological Seminary George Trumbull Ladd, (born January 19, 1842, Painesville, Ohio, U.S.—died August 8, 1921, New Haven, Connecticut), philosopher and psychologist whose textbooks were influential in establishing experimental psychology in the United States. He called for a scientific psychology, but he viewed psychology as ancillary to philosophy. He was a grandson of Jesse Ladd and Ruby Brewster, who were among the original pioneers in Madison, Lake County, Ohio. Ruby was a granddaughter of Oliver Brewster and Martha Wadsworth Brewster, a poet and writer, and one of the earliest American female literary figures. Ladd’s main interest was in writing Elements of Physiological Psychology (1887), the first handbook of its kind in English. Because of its emphasis on neurophysiology, it long remained a standard work. In addition, Ladd’s Psychology, Descriptive and Explanatory (1894) is important as a theoretical system of functional psychology, considering the human being as an organism with a mind purposefully solving problems and adapting to its environment. He early gave indications of the studious habits that characterized him through life.
  • The Psychophysics of Consciousness: a Hypothesis

    The Psychophysics of Consciousness: a Hypothesis

    S.R. Joye The Psychophysics of Consciousness The Psychophysics of Consciousness: A Hypothesis "Hypothesis: a very poor choice of word to designate the supreme spiritual act by which the dust-cloud of experience takes on form and is kindled at the fire of knowledge." Pierre Teilhard de Chardin August 9, 2013 S.R. Joye, B.S. Electrical Engineering, M.A. Asian Philosophy, CIIS Doctoral Candidate, Department of Philosophy & Religion Concentration in Philosophy, Cosmology, and Consciousness PARP 9600 – Doctoral Comprehensive Exam Paper Professor Allan Combs School of Consciousness and Transformation Summer Semester 2013 Comp. Exam Part II The Psychophysics of Consciousness The Psychophysics of Consciousness: A Hypothesis Abstract Gustav Fechner, the German experimental psychologist, coined the term psychophysics in 1860, publishing the first mathematical equation to model human consciousness.1 Fechner assumed that any future approaches to consciousness would include mathematical and physical underpinnings. In 1995, the cognitive scientist and philosopher David Chalmers coined the phrase "the hard problem" as being that of connecting consciousness with some physical substrate. According to Chalmers, "The really hard problem of consciousness is the problem of experience. Most existing theories of consciousness either deny the phenomenon, explain something else, or elevate the problem to an eternal mystery."2 As Chalmers points out, unfortunately, the modern scientific community has not yet produced a model of consciousness supported by mathematics and physics, thus no progress in Fecher's "psychophysics." However there is growing interest among the scientific community in string theory, the only branch of mathematical geometry that has successfully explained recent discoveries in high energy particle physics.
  • Seventeen Early Peace Psychologists

    Seventeen Early Peace Psychologists

    Seventeen Early Peace Psychologists By Floyd Rudmin Rudmin, Floyd (1991). Seventeen Early Peace Psychologists. In Journal of Humanistic Psychology, Vol. 31, No. 2, Spring, pp. 12-43, 1991 Sage Publications, Inc. Floyd Webster Rudmin is a boundary crosser. In many societies (e.g., the Inuit), boundary crossers are obliged to try to interpret and intercede for those on either side of the boundary. Dr. Rudmin completed a B.A. in philosophy at Bowdoin College in Maine, an M. A. in audiology at SUNY Buffalo, and a Ph.D. in social psychology at Queen University in Ontario. He has lived and worked in the United States, the Philippines, Japan, and since 1978 in Canada. His spouse, Toyoko, is Japanese. Their children are schooled in French. The primary focus of Dr. Rudmin research is the psychology of ownership and possession. He is currently an assistant professor in Queen Faculty of Law and School of Business. History of psychology is his pleasure. Peace is his passion. Summary Peace psychology has a history that is both long and prominent. However, that fact is little known and little appreciated, even among contemporary peace-activist psychologists. This article presents 17 brief biographies of psychologists who are part of this important heritage: Pythagoras, Jeremy Bentham, Franz Brentano, William James, August Forel, Ivan Pavlov, Sigmund Freud, James McKeen Cattell, Mary Whiton Calkins, Alexander Chamberlain, Alfred Adler, William McDougall, Edward Tolman, Gordon Allport, Gustav Ichheiser, Margaret Mead, and Charles Osgood. It is important that more recognition and appreciation be given to the long and prominent history of psychology in peace research and peace activism.
  • Empfindungsfähigkeit Und Moralischer Status Eine Kritik Der Pathozentrischen Ethik

    Empfindungsfähigkeit Und Moralischer Status Eine Kritik Der Pathozentrischen Ethik

    Empfindungsfähigkeit und moralischer Status Eine Kritik der pathozentrischen Ethik Inauguraldissertation zur Erlangung des Doktorgrades der Philosophie im Fachbereich A Geistes- und Kulturwissenschaften der Bergischen Universität Wuppertal vorgelegt von Erasmus Scheuer aus Düsseldorf Wuppertal, im Januar 2018 Die Dissertation kann wie folgt zitiert werden: urn:nbn:de:hbz:468-20180503-133904-3 [http://nbn-resolving.de/urn/resolver.pl?urn=urn%3Anbn%3Ade%3Ahbz% 3A468-20180503-133904-3] alles bleibt wie es ist Geheimnis in einem Geheimnis Muster in einem Muster (Norbert Scheuer – Nichts) Meinen Eltern, Elvira und Norbert Scheuer Vorwort Der Pathozentrismus betrachtet die Leidens- oder Empfindungsfähigkeit aller, auch nichtmenschlicher Spezies als zentrales moralisches Kriterium. Diese Arbeit hat die pathozentrische Position zum Gegenstand und bewegt sich bewusst zwischen Kritik und Verteidigung eines solchen Ansatzes. Einerseits liegen die Schwächen des Pa- thozentrismus m.E. mehr oder weniger offen zu Tage, da die Kluft zwischen Empfin- dungen des Menschen und den Empfindungen anderer Spezies nur schwer inner- halb eines naturwissenschaftlich-physikalistischen Weltbildes überbrückbar erscheint. Andererseits vertrete ich als Verfasser dieser Arbeit die Ansicht, dass eine Erweiterung der Moralobjekte über die Menschen hinaus erfolgen muss, dass das Leiden anderer Kreaturen Teil einer jeden ethischen Betrachtung sein sollte. Der Pa- thozentrismus vertritt mit seinem Kriterium der Leidens- bzw. Empfindungsfähigkeit eine ethische Position, die vom Ansatz her eine Erweiterung der Moralobjekte an- strebt. Aus diesem Grund liegt meine Sympathie beim Pathozentristen. Infolgedes- sen versucht diese Arbeit, einerseits die Kritik am Pathozentrismus aufzuzeigen, an- dererseits dem Pathozentristen auch Argumente an die Hand zu geben, die es ihm erlauben, seine Position zu verteidigen. Der Pathozentrist hat nach meiner Ansicht zwei schwerwiegende und grundlegende Probleme, wenn er seine Ethik innerhalb eines tendenziell physikalistischen Weltbildes zu verteidigen sucht.
  • Weber-Fechner Law Forrest W

    Weber-Fechner Law Forrest W

    Plant Pathology and Microbiology Publications Plant Pathology and Microbiology 7-2010 Weber-Fechner Law Forrest W. Nutter Jr. Iowa State University, [email protected] Follow this and additional works at: http://lib.dr.iastate.edu/plantpath_pubs Part of the Agricultural Science Commons, Agriculture Commons, and the Plant Pathology Commons The ompc lete bibliographic information for this item can be found at http://lib.dr.iastate.edu/ plantpath_pubs/71. For information on how to cite this item, please visit http://lib.dr.iastate.edu/ howtocite.html. This Book Chapter is brought to you for free and open access by the Plant Pathology and Microbiology at Iowa State University Digital Repository. It has been accepted for inclusion in Plant Pathology and Microbiology Publications by an authorized administrator of Iowa State University Digital Repository. For more information, please contact [email protected]. Weber-Fechner Law Abstract Several models have been proposed in the field of psychophysics to quantify relationships between any stimulus (e.g., touch, sound, light, and smell) and the perceived response by individuals. One such model is referred to as the Weber-Fechner Law. The eW ber −Fechner Law, however, is not one law, but two separate laws: Weber's Law and Fechner's Law. Moreover, not all human senses respond to stimuli according to Fechner's law (in fact many do not). Weber's Law and special cases such as Fechner's Law are each based on the “just noticeable difference threshold” concept. Disciplines Agricultural Science | Agriculture | Plant Pathology Comments This chapter is from Encyclopedia of Research Design (2010): 1612, doi:10.4135/9781412961288.n494.
  • The Misogyny of Psychology: a Tribute to Women Often Overlooked

    The Misogyny of Psychology: a Tribute to Women Often Overlooked

    Bowling Green State University ScholarWorks@BGSU Honors Projects Honors College Spring 5-8-2020 The Misogyny of Psychology: A Tribute to Women Often Overlooked Gabrielle Miller [email protected] Follow this and additional works at: https://scholarworks.bgsu.edu/honorsprojects Part of the Feminist, Gender, and Sexuality Studies Commons, and the Psychology Commons Repository Citation Miller, Gabrielle, "The Misogyny of Psychology: A Tribute to Women Often Overlooked" (2020). Honors Projects. 519. https://scholarworks.bgsu.edu/honorsprojects/519 This work is brought to you for free and open access by the Honors College at ScholarWorks@BGSU. It has been accepted for inclusion in Honors Projects by an authorized administrator of ScholarWorks@BGSU. Table of Contents Preface 3 Mary Whiton Calkins 4 Melanie Klein 5 Karen Horney 6 Leta Stetter Hollingworth 7 Inez Prosser 8 Anna Freud 9 Mary Ainsworth 10 Bernice Neugarten 11 Mamie Phipps Clark 12 Janet Taylor Spence 13 Florence Denmark 14 Bonnie Strickland 15 Afterword 16 References 18 2 | P a g e Preface The basis for this project stemmed from my passion for spreading positive energy. Additionally, my altruistic values provide me with a strong sense of duty to do the right thing at the same time that I believe it is my responsibility to help others, especially because I have been afforded the luxury of a college education although many others do not share this privilege. Under those circumstances, I wanted to speak on the issue of inequal representation of diverse identities, with special attention to the branches of science which historically refused to give due credit to individuals other than straight, white men.
  • Research Methods, Design, and Analysis TWELFTH EDITION • •

    Research Methods, Design, and Analysis TWELFTH EDITION • •

    GLOBAL EDITION Research Methods, Design, and Analysis TWELFTH EDITION •• Larry B. Christensen • R. Burke Johnson • Lisa A. Turner Executive Editor: Stephen Frail Acquisitions Editor, Global Edition: Sandhya Ghoshal Editorial Assistant: Caroline Beimford Editorial Assistant: Sinjita Basu Marketing Manager: Jeremy Intal Senior Manufacturing Controller, Production, Global Edition: Digital Media Editor: Lisa Dotson Trudy Kimber Media Project Manager: Pam Weldin Senior Operations Supervisor: Mary Fischer Managing Editor: Linda Behrens Operations Specialist: Diane Peirano Production Project Manager: Maria Piper Cover Designer: Head of Learning Asset Acquisitions, Global Edition: Cover Photo: Shutterstock/Tashatuvango Laura Dent Full-Service Project Management: Anandakrishnan Natarajan/ Publishing Operations Director, Global Edition: Angshuman Integra Software Services, Ltd. Chakraborty Cover Printer: Lehigh-Phoenix Color/Hagerstown Publishing Administrator and Business Analyst, Global Edition: Shokhi Shah Khandelwal Pearson Education Limited Edinburgh Gate Harlow Essex CM20 2JE England and Associated Companies throughout the world Visit us on the World Wide Web at: www.pearsonglobaleditions.com © Pearson Education Limited 2015 The rights of Larry B. Christensen, R. Burke Johnson, and Lisa A. Turner to be identified as the authors of this work have been asserted by them in accordance with the Copyright, Designs and Patents Act 1988. Authorized adaptation from the United States edition, entitled Research Methods, Design, and Analysis, 12th edition,
  • Points of View in the Modern History of Psychology

    Points of View in the Modern History of Psychology

    Points of View in the Modern History of Psychology Edited by Claude E. Buxton Department of Psychology Yale University New Haven, Connecticut 1985 ACADEMIC PRESS, INC. (Harcourt Brace Jovanovich, Publishers) Orlando San Diego New York London Toronto Montreal Sydney Tokyo Passages from the following are reprinted by permission of the publishers: Newell, Α., Duncker on Thinking, in S. Koch & D. Leary (Eds.), A Century of Psychology as Science. Copyright 1985 by McGraw-Hill. Neisser, U., Cognitive Psychology. © 1967 by Prentice-Hall. COPYRIGHT © 1985 BY ACADEMIC PRESS, INC. ALL RIGHTS RESERVED. NO PART OF THIS PUBLICATION MAY BE REPRODUCED OR TRANSMITTED IN ANY FORM OR BY ANY MEANS, ELECTRONIC OR MECHANICAL, INCLUDING PHOTOCOPY, RECORDING, OR ANY INFORMATION STORAGE AND RETRIEVAL SYSTEM, WITHOUT PERMISSION IN WRITING FROM THE PUBLISHER. ACADEMIC PRESS, INC. Orlando, Florida 32887 United Kingdom Edition published by ACADEMIC PRESS INC. (LONDON) LTD. 24-28 Oval Road, London NW1 7DX LIBRARY OF CONGRESS CATALOGING IN PUBLICATION DATA Main entry under title: Points of view in the modern history of psychology. Includes indexes. 1. Psychology— History. I. Buxton, Claude E. BF81.P57 1985 150\9 85-4010 ISBN 0-12-148510-2 (alk. paper) PRINTED IN THE UNITED STATES OF AMERICA 85 86 87 88 9 8 7 6 5 4 3 2 1 Contributors Numbers in parentheses indicate the pages on which the authors' contributions begin. Mitchell G. Ash (295), Department of History, University of Iowa, Iowa City, Iowa 52242 William Bevan (259), John D. and Catherine T. MacArthur Foundation, Chicago, Illinois 60603 Arthur L. Blumenthal (19, 51), Department of Psychology, University of Massachusetts at Boston, Boston, Massachusetts 02125 Claude E.