DOCSLIB.ORG

216141 2 En Bookbackmatter 461..490

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
216141 2 En Bookbackmatter 461..490 Glossary A2BP1 ataxin 2-binding protein 1 (605104); 16p13 ABAT 4-(gamma)-aminobutyrate transferase (137150); 16p13.3 ABCA5 ATP-binding cassette, subfamily A, member 5 (612503); 17q24.3 ABCD1 ATP-binding cassette, subfamily D, member 1 (300371):Xq28 ABR active BCR-related gene (600365); 17p13.3 ACR acrosin (102480); 22q13.33 ACTB actin, beta (102630); 7p22.1 ADHD attention deficit hyperactivity disorder—three separate conditions ADD, ADHD, HD that manifest as poor focus with or without uncontrolled, inap- propriately busy behavior, diagnosed by observation and quantitative scores from parent and teacher questionnaires ADSL adenylosuccinate lyase (608222); 22q13.1 AGL amylo-1,6-glucosidase (610860); 1p21.2 AGO1 (EIF2C1), AGO3 (EIF2C3) argonaute 1 (EIF2C1, eukaryotic translation initiation factor 2C, subunit 1 (606228); 1p34.3, argonaute 3 (factor 2C, subunit 3—607355):1p34.3 AKAP8, AKAP8L A-kinase anchor protein (604692); 19p13.12, A-kinase anchor protein 8-like (609475); 19p13.12 ALG6 S. cerevisiae homologue of, mutations cause congenital disorder of glyco- sylation (604566); 1p31.3 Alopecia absence of hair ALX4 aristaless-like 4, mouse homolog of (605420); 11p11.2 As elsewhere in this book, 6-digit numbers in parentheses direct the reader to gene or disease descriptions in the Online Mendelian Disease in Man database (www.omim.org) © Springer Nature Singapore Pte Ltd. 2017 461 H.E. Wyandt et al., Human Chromosome Variation: Heteromorphism, Polymorphism and Pathogenesis, DOI 10.1007/978-981-10-3035-2 462 Glossary GRIA1 glutamate receptor, ionotropic, AMP1 (138248); 5q33.2 ANKRD11 ankyrin repeat domain-containing protein 11 (611192); 16q24.3 Anomaly deviation from the expected or average type in structure, form and/or function which is interpreted as abnormal APBA2 amyloid beta A4 precursor protein-binding, family A (602712); 15q13.1 APC adenomatous polyposis coli (611731); 5q21q22 AQP4 aquaporin 4; 18q11.2q12.1 Arachnodactyly long (spider) fingers ARFRP1 ADP-ribosylation factor-related protein 1 (604699); 20q13.3 ARHGAP4 rho GTPase-activating protein 4 (300023); Xq28 ARHGEF7 rho guanine nucleotide exchange factor 7 (605477); 13q34 ARID1B AT-rich interaction domain-containing protein 1B (614556); 6q25.3 ARRDC3 arrestin domain-containing 3 (612464); 5q14.3 ARSE arylsulfatase E (300180); Xp22 ARSK arylsulfatase K (610011); 5q13 ARX aristaless-related homeobox, X-linked (300382); Xp22.13 Association Groups of anomalies that occur together more often than by chance, lacking hierarchical frequencies and characteristic facial appearance of malfor- mation syndromes ASXL1 additional sex combs-like 1 (612990); 20q11.21 AUTS14B autism susceptibility locus 14B (614671) Ataxia abnormally coordinated movements including clumsy gait as if intoxicated ATP2C2 ATPase, Ca(2+)-transporting, type 2C, member 2 (613082); 16q24.1 ATR ataxia-telangiectasia and RAD3-related (601215): 3q23 Auditory processing disorder normal hearing with delay in interpreting language Autism, autism spectrum disorder triad of poor socialization, poor communi- cation, and restricted interests/obsessive focus AVPR1A, AVPR2 arginine vasopressin receptor 1A (600821); 12q14.2, receptor 2 (300538); Xq28 B3GALTL beta-glucosyltransferase (610308); 13q12.3 BCAP1 B-cell receptor-associated protein 31 (300398); Xq28 BCL11A B-cell CLL/lymphoma 11A(606557); 2p16.1 Glossary 463 BDNF brain-derived neurotropic factor (115505); 11p13 BHLHA9 basic helix-loop-helix family, member A9 (615416): 17p13.3 Bicornuate, didelphic uterus uterus divided into two upper lobes, often with septum Bifid uvula bifurcation of midline fleshy lobule behind palate Bitemporal narrowing or hollowing concavity at temples when viewed frontally, often seen with severe hypotonia Blepharophimosis increased flesh around eyes making the palpebral fissures look narrow BMP2 bone morphogenetic protein 2 (112261); 20p12.3 BMPR1A bone morphogenetic protein receptor, type 1A (601299); 10q23.2 Bone age, delayed or advanced Age estimated from skeletal x-rays based on schedule of bone epiphysis closure, behind or ahead of chronologic age Brachycephaly flat occiput, opposite of dolichocephaly/scaphocephaly Brachydactyly fingers drastically shortened BRCA2 breast-ovarian cancer gene 2 (600185); 13q13.1 Broad forehead wide forehead, different from prominent forehead that bows frontally (frontal bossing) BSX brain-specific homeobox, mouse homologue of (611074); 11q24.1 C2ORF34 (CAMKMT) chromosome 2 open reading frame (calmodulin lysine N-methyltransferase–609559); 2p21 C5ORF36 (KIAA0825) chromosome 5 open reading frame 36 (not listed); 5q14— www.genecards.org/cgi-bin/carddisp.pl?gene=KIAA0825&keywords=C5orf36 C6orf70 (ERMARD) chromosome 6 open reading frame (endoplasmic reticulum membrane-associated RNA degradation protein—615532); 6q27 CACNA1C calcium channel, voltage-dependent, L type, alpha-1C subunit (114205); 12p13.3 CADPS2 calcium-dependent activator protein for secretion 2 (609978); 7q31.3 CALR3 calreticulin 3 (611414)—calcium-binding chaperone localized mainly in endoplasmic reticulum; 19p13.11 Camptodactyly finger bending forward (contracted); claw hand when all contracted CAST calpastatin isoform h (114090)—endogenous calpain (calcium-dependent cysteine protease inhibitor); 5q15 464 Glossary Cataract, corneal opacity respective clouding of eye lens or cornea (surface of eye) CC2D1A coiled-coil and C2 domains-containing protein 1A (610095): 19p13.12 CDH9, CDH10 cadherin 9 (609974); 5p14.1, cadherin 10 (604555); 5p15.1/.2— cadherins are integral membrane proteins that medicate Ca-dependent cell adhesion CDKL5 cyclin-dependent kinase-like 5 (300203); Xp22.13 CDKN1C cyclin-dependent kinase inhibitor 1C gene (600856); 11p14 CENPL centromeric protein L (611503)—a protein essential for proper kineto- chore function and mitotic progression; 1q25.1 CENTG2 (AGAP1) centaurin, gamma-2 (ARF GTPase-activating protein with GTPase domain—608651)—member of GTPase-activating protein family involved in membrane traffic and actin cytoskeleton dynamics; 2q37.3 Cervical sinuses fleshy openings in neck, remnants of the branchial grooves CETN3 centrin 3 centrosomic protein with 4 calcium-binding domains (602907); 5q14.3—centrins are members of a calcium-binding EF-hand protein super- family present in the centromeres of may eucaryotes CFTR cystic fibrosis transmembrane conductance regulator (602421); 7q31.2— encodes an ATP-binding cassette (ABC) transporter that functions as a chloride channel, mutated in cystic fibrosis CHAT choline acetyltransferase (118490); 10q11.23—biosynthetic enzyme for acetylcholine in central/peripheral nervous system CHD7, CHD8 chromodomain helicase DNA binding protein 7 (608892); 8q12.2, protein 8 (610528); 14q11.2 CHL1 (L1CAM2) cell-adhesion molecule L1-like (L1 cell adhesion molecule 2— 607417); 3p26.3 Choanal atresia or stenosis absence or narrowing of the upper bony nasal passages CHRM3 acetylcholine receptor, muscarinic, 3 (118494); 1q43 CHRNA4, CHRNA7 cholinergic receptor, neuronal nicotinic, alpha polypeptide 4 (118504); 20q13.3, polypeptide 7 (118511); 15q14 Claw hand bending forward or camptodactyly of all fingers and thumb Cleft lip/palate congenital failure of the upper lip or upper mouth (soft or hard palate) to fuse—cleft lip, cleft palate, or both may occur; a posterior midline U-shaped cleft of the soft palate occurs with Pierre Robin sequence because the small jaw pushes the tongue upward and interferes with palatal fusion Glossary 465 CLIC2 chloride intracellular chloride channel 2 (300138); Xq28 Clinodactyly lateral curving of a digit as opposed to the forward curve (contrac- ture) of camptodactyly CLPTM1L (CRR9) CLPTM1-like protein (cisplatin resistance-related protein 9 (612585); 5p15.33 CMIP C-MAF-inducing protein (610112); 16q23.2/.3—MAF is the avian mus- culoaponeurotic fibrosarcoma oncogene homolog CNTN3, CNTN4 contactin 3 (601325); 3p12.3, contactin 4 (607280); 3p26.3/.2— contactins are axon-associated cell adhesion molecular of the IG superfamily that play important roles in sculpting neural networks CNTNAP2 contactin-associated protein-like 2 (604569); 7q35q36 Coarse facies increased subcutaneous tissue of the face leading to a coarsened appearance Coloboma cleft of the iris that may extend to the retina, always inferior due to lack of eye cup fusion COMT catechol-o-methyltransferase (116790; 22q11.21)—the enzyme most involved in degradation of catecholamines Cortical dysplasia abnormal development of the outer layer of the brain (cortex), often detected as reduced cortical area by head MRI study COX7C cytochrome c oxidase subunit 7C precursor (603774); 5q14.3– nuclear-encoded component of the cytochrome c oxidase complex within mitochondria Craniosynostosis premature fusion of the cranial sutures that allow brain expan- sion during childhood growth CRK V-CRK avian sarcoma virus CT10 oncogene homolog (164762); 17p13.3 Cryptorchidism undescended testes, often accompanied by inguinal hernia and small scrotum CSMD3 cub and sushi multiple domains 3 (608399); 8q23.3—CUB indicates Complement C1r-U epidermal growth factor UEGF-bone morphogenetic protein BMP1, a domain in proteins with many functions ranging from complement activation, hemostasis or neural development/signal transduction; sushi is a complement control module CTNNA2, CTNND2 catenin, alpha-2 (114025); 2p12, catenin, delta-2 (604275); 5p15.2—catenins anchor cadherins to cell membranes Cupid’s bow lip enhanced curvature of the upper lip in the shape of a handle-bar mustache 466 Glossary Cutis aplasia area lacking skin, initially fleshy, then white
Load more

Recommended publications
  • Nuclear and Mitochondrial Genome Defects in Autisms
    UC Irvine UC Irvine Previously Published Works Title Nuclear and mitochondrial genome defects in autisms. Permalink https://escholarship.org/uc/item/8vq3278q Journal Annals of the New York Academy of Sciences, 1151(1) ISSN 0077-8923 Authors Smith, Moyra Spence, M Anne Flodman, Pamela Publication Date 2009 DOI 10.1111/j.1749-6632.2008.03571.x License https://creativecommons.org/licenses/by/4.0/ 4.0 Peer reviewed eScholarship.org Powered by the California Digital Library University of California THE YEAR IN HUMAN AND MEDICAL GENETICS 2009 Nuclear and Mitochondrial Genome Defects in Autisms Moyra Smith, M. Anne Spence, and Pamela Flodman Department of Pediatrics, University of California, Irvine, California In this review we will evaluate evidence that altered gene dosage and structure im- pacts neurodevelopment and neural connectivity through deleterious effects on synap- tic structure and function, and evidence that the latter are key contributors to the risk for autism. We will review information on alterations of structure of mitochondrial DNA and abnormal mitochondrial function in autism and indications that interactions of the nuclear and mitochondrial genomes may play a role in autism pathogenesis. In a final section we will present data derived using Affymetrixtm SNP 6.0 microar- ray analysis of DNA of a number of subjects and parents recruited to our autism spectrum disorders project. We include data on two sets of monozygotic twins. Col- lectively these data provide additional evidence of nuclear and mitochondrial genome imbalance in autism and evidence of specific candidate genes in autism. We present data on dosage changes in genes that map on the X chromosomes and the Y chro- mosome.
    [Show full text]
  • Prioritization and Evaluation of Depression Candidate Genes by Combining Multidimensional Data Resources
    Prioritization and Evaluation of Depression Candidate Genes by Combining Multidimensional Data Resources Chung-Feng Kao1, Yu-Sheng Fang2, Zhongming Zhao3, Po-Hsiu Kuo1,2,4* 1 Department of Public Health and Institute of Epidemiology and Preventive Medicine, College of Public Health, National Taiwan University, Taipei, Taiwan, 2 Institute of Clinical Medicine, School of Medicine, National Cheng-Kung University, Tainan, Taiwan, 3 Departments of Biomedical Informatics and Psychiatry, Vanderbilt University School of Medicine, Nashville, Tennessee, United States of America, 4 Research Center for Genes, Environment and Human Health, National Taiwan University, Taipei, Taiwan Abstract Background: Large scale and individual genetic studies have suggested numerous susceptible genes for depression in the past decade without conclusive results. There is a strong need to review and integrate multi-dimensional data for follow up validation. The present study aimed to apply prioritization procedures to build-up an evidence-based candidate genes dataset for depression. Methods: Depression candidate genes were collected in human and animal studies across various data resources. Each gene was scored according to its magnitude of evidence related to depression and was multiplied by a source-specific weight to form a combined score measure. All genes were evaluated through a prioritization system to obtain an optimal weight matrix to rank their relative importance with depression using the combined scores. The resulting candidate gene list for depression (DEPgenes) was further evaluated by a genome-wide association (GWA) dataset and microarray gene expression in human tissues. Results: A total of 5,055 candidate genes (4,850 genes from human and 387 genes from animal studies with 182 being overlapped) were included from seven data sources.
    [Show full text]
  • Genome-Wide Analysis of Host-Chromosome Binding Sites For
    Lu et al. Virology Journal 2010, 7:262 http://www.virologyj.com/content/7/1/262 RESEARCH Open Access Genome-wide analysis of host-chromosome binding sites for Epstein-Barr Virus Nuclear Antigen 1 (EBNA1) Fang Lu1, Priyankara Wikramasinghe1, Julie Norseen1,2, Kevin Tsai1, Pu Wang1, Louise Showe1, Ramana V Davuluri1, Paul M Lieberman1* Abstract The Epstein-Barr Virus (EBV) Nuclear Antigen 1 (EBNA1) protein is required for the establishment of EBV latent infection in proliferating B-lymphocytes. EBNA1 is a multifunctional DNA-binding protein that stimulates DNA replication at the viral origin of plasmid replication (OriP), regulates transcription of viral and cellular genes, and tethers the viral episome to the cellular chromosome. EBNA1 also provides a survival function to B-lymphocytes, potentially through its ability to alter cellular gene expression. To better understand these various functions of EBNA1, we performed a genome-wide analysis of the viral and cellular DNA sites associated with EBNA1 protein in a latently infected Burkitt lymphoma B-cell line. Chromatin-immunoprecipitation (ChIP) combined with massively parallel deep-sequencing (ChIP-Seq) was used to identify cellular sites bound by EBNA1. Sites identified by ChIP- Seq were validated by conventional real-time PCR, and ChIP-Seq provided quantitative, high-resolution detection of the known EBNA1 binding sites on the EBV genome at OriP and Qp. We identified at least one cluster of unusually high-affinity EBNA1 binding sites on chromosome 11, between the divergent FAM55 D and FAM55B genes. A con- sensus for all cellular EBNA1 binding sites is distinct from those derived from the known viral binding sites, sug- gesting that some of these sites are indirectly bound by EBNA1.
    [Show full text]
  • AGAP1 (NM 014914) Human Recombinant Protein Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TP314836 AGAP1 (NM_014914) Human Recombinant Protein Product data: Product Type: Recombinant Proteins Description: Recombinant protein of human ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 (AGAP1), transcript variant 2 Species: Human Expression Host: HEK293T Tag: C-Myc/DDK Predicted MW: 88.9 kDa Concentration: >50 ug/mL as determined by microplate BCA method Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. Storage: Store at -80°C. Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. RefSeq: NP_055729 Locus ID: 116987 UniProt ID: Q9UPQ3 RefSeq Size: 4078 Cytogenetics: 2q37.2 RefSeq ORF: 2412 Synonyms: AGAP-1; CENTG2; cnt-g2; GGAP1 Summary: This gene encodes a member of an ADP-ribosylation factor GTPase-activating protein family involved in membrane trafficking and cytoskeleton dynamics. This gene functions as a direct regulator of the adaptor-related protein complex 3 on endosomes. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 AGAP1 (NM_014914) Human Recombinant Protein – TP314836 Protein Pathways: Endocytosis Product images: Coomassie blue staining of purified AGAP1 protein (Cat# TP314836).
    [Show full text]
  • AKAP8L Rabbit Polyclonal Antibody – TA329433 | Origene
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA329433 AKAP8L Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for Anti-AKAP8L antibody is: synthetic peptide directed towards the C- terminal region of Human AKAP8L. Synthetic peptide located within the following region: NNKLISKKLERYLKGENPFTDSPEEEKEQEEAEGGALDEGAQGEAAGISE Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Affinity Purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 64 kDa Gene Name: A-kinase anchoring protein 8 like Database Link: NP_055186 Entrez Gene 26993 Human Q9ULX6 Background: AKAP8L could play a role in constitutive transport element (CTE)-mediated gene expression. It does not seem to be implicated in the binding of regulatory subunit II of PKA. It may be involved in nuclear envelope breakdown and chromatin condensation. It may regulate the initiation phase of DNA replication when associated with TMPO-beta. Synonyms: HA95; HAP95; NAKAP; NAKAP95 This product is to be used for laboratory only. Not for diagnostic
    [Show full text]
  • Genotyping of Breech Flystrike Resource – Update
    Project No: ON-00515 Contract No: PO4500010753 AWI Project Manager: Bridget Peachey Contractor Name: CSIRO Agriculture and Food Prepared by: Dr Sonja Dominik Publication Date: July 2019 Genotyping of breech flystrike resource – update Published by Australian Wool Innovation Limited, Level 6, 68 Harrington Street, THE ROCKS, NSW, 2000 This publication should only be used as a general aid and is not a substitute for specific advice. To the extent permitted by law, we exclude all liability for loss or damage arising from the use of the information in this publication. AWI invests in research, development, innovation and marketing activities along the global supply chain for Australian wool. AWI is grateful for its funding, which is primarily provided by Australian woolgrowers through a wool levy and by the Australian Government which provides a matching contribution for eligible R&D activities © 2019 Australian Wool Innovation Ltd. All rights reserved. Contents Executive Summary .................................................................................................................... 3 1 Introduction/Hypothesis .................................................................................................... 5 2 Literature Review ............................................................................................................... 6 3 Project Objectives .............................................................................................................. 8 4 Success in Achieving Objectives ........................................................................................
    [Show full text]
  • Evidence for Differential Alternative Splicing in Blood of Young Boys With
    Stamova et al. Molecular Autism 2013, 4:30 http://www.molecularautism.com/content/4/1/30 RESEARCH Open Access Evidence for differential alternative splicing in blood of young boys with autism spectrum disorders Boryana S Stamova1,2,5*, Yingfang Tian1,2,4, Christine W Nordahl1,3, Mark D Shen1,3, Sally Rogers1,3, David G Amaral1,3 and Frank R Sharp1,2 Abstract Background: Since RNA expression differences have been reported in autism spectrum disorder (ASD) for blood and brain, and differential alternative splicing (DAS) has been reported in ASD brains, we determined if there was DAS in blood mRNA of ASD subjects compared to typically developing (TD) controls, as well as in ASD subgroups related to cerebral volume. Methods: RNA from blood was processed on whole genome exon arrays for 2-4–year-old ASD and TD boys. An ANCOVA with age and batch as covariates was used to predict DAS for ALL ASD (n=30), ASD with normal total cerebral volumes (NTCV), and ASD with large total cerebral volumes (LTCV) compared to TD controls (n=20). Results: A total of 53 genes were predicted to have DAS for ALL ASD versus TD, 169 genes for ASD_NTCV versus TD, 1 gene for ASD_LTCV versus TD, and 27 genes for ASD_LTCV versus ASD_NTCV. These differences were significant at P <0.05 after false discovery rate corrections for multiple comparisons (FDR <5% false positives). A number of the genes predicted to have DAS in ASD are known to regulate DAS (SFPQ, SRPK1, SRSF11, SRSF2IP, FUS, LSM14A). In addition, a number of genes with predicted DAS are involved in pathways implicated in previous ASD studies, such as ROS monocyte/macrophage, Natural Killer Cell, mTOR, and NGF signaling.
    [Show full text]
  • Genome-Wide Analysis of ATP-Binding
    Tian et al. BMC Genomics (2017) 18:330 DOI 10.1186/s12864-017-3706-6 RESEARCH ARTICLE Open Access Genome-wide analysis of ATP-binding cassette (ABC) transporters in the sweetpotato whitefly, Bemisia tabaci Lixia Tian1, Tianxue Song2, Rongjun He1, Yang Zeng1, Wen Xie1, Qingjun Wu1, Shaoli Wang1, Xuguo Zhou3* and Youjun Zhang1* Abstract Background: ABC transporter superfamily is one of the largest and ubiquitous groups of proteins. Because of their role in detoxification, insect ABC transporters have gained more attention in recent years. In this study, we annotated ABC transporters from a newly sequenced sweetpotato whitefly genome. Bemisia tabaci Q biotype is an emerging global invasive species that has caused extensive damages to field crops as well as ornamental plants. Results: A total of 55 ABC transporters containing all eight described subfamilies (A to H) were identified in the B. tabaci Q genome, including 8 ABCAs, 3 ABCBs, 6 ABCCs, 2 ABCDs, 1 ABCE, 3 ABCFs, 23 ABCGs and 9 ABCHs. In comparison to other species, subfamilies G and H in both phloem- and blood-sucking arthropods are expanded. The temporal expression profiles of these 55 ABC transporters throughout B. tabaci developmental stages and their responses to imidacloprid, a neonicotinoid insecticide, were investigated using RNA-seq analysis. Furthermore, the mRNA expression of 24 ABC transporters (44% of the total) representing all eight subfamilies was confirmed by the quantitative real-time PCR (RT-qPCR). Furthermore, mRNA expression levels estimated by RT-qPCR and RNA-seq analyses were significantly correlated (r =0.684,p <0.01). Conclusions: It is the first genome-wide analysis of the entire repertoire of ABC transporters in B.
    [Show full text]
  • Primate Specific Retrotransposons, Svas, in the Evolution of Networks That Alter Brain Function
    Title: Primate specific retrotransposons, SVAs, in the evolution of networks that alter brain function. Olga Vasieva1*, Sultan Cetiner1, Abigail Savage2, Gerald G. Schumann3, Vivien J Bubb2, John P Quinn2*, 1 Institute of Integrative Biology, University of Liverpool, Liverpool, L69 7ZB, U.K 2 Department of Molecular and Clinical Pharmacology, Institute of Translational Medicine, The University of Liverpool, Liverpool L69 3BX, UK 3 Division of Medical Biotechnology, Paul-Ehrlich-Institut, Langen, D-63225 Germany *. Corresponding author Olga Vasieva: Institute of Integrative Biology, Department of Comparative genomics, University of Liverpool, Liverpool, L69 7ZB, [email protected] ; Tel: (+44) 151 795 4456; FAX:(+44) 151 795 4406 John Quinn: Department of Molecular and Clinical Pharmacology, Institute of Translational Medicine, The University of Liverpool, Liverpool L69 3BX, UK, [email protected]; Tel: (+44) 151 794 5498. Key words: SVA, trans-mobilisation, behaviour, brain, evolution, psychiatric disorders 1 Abstract The hominid-specific non-LTR retrotransposon termed SINE–VNTR–Alu (SVA) is the youngest of the transposable elements in the human genome. The propagation of the most ancient SVA type A took place about 13.5 Myrs ago, and the youngest SVA types appeared in the human genome after the chimpanzee divergence. Functional enrichment analysis of genes associated with SVA insertions demonstrated their strong link to multiple ontological categories attributed to brain function and the disorders. SVA types that expanded their presence in the human genome at different stages of hominoid life history were also associated with progressively evolving behavioural features that indicated a potential impact of SVA propagation on a cognitive ability of a modern human.
    [Show full text]
  • APBA2 Antibody A
    C 0 2 - t APBA2 Antibody a e r o t S Orders: 877-616-CELL (2355) [email protected] Support: 877-678-TECH (8324) 3 9 Web: [email protected] 5 www.cellsignal.com 8 # 3 Trask Lane Danvers Massachusetts 01923 USA For Research Use Only. Not For Use In Diagnostic Procedures. Applications: Reactivity: Sensitivity: MW (kDa): Source: UniProt ID: Entrez-Gene Id: WB, IP M R Endogenous 135 Rabbit Q99767 321 Product Usage Information Application Dilution Western Blotting 1:1000 Immunoprecipitation 1:50 Storage Supplied in 10 mM sodium HEPES (pH 7.5), 150 mM NaCl, 100 µg/ml BSA and 50% glycerol. Store at –20°C. Do not aliquot the antibody. Specificity / Sensitivity APBA2 Antibody recognizes endogenous levels of total APBA2 protein. Species Reactivity: Mouse, Rat Species predicted to react based on 100% sequence homology: Human Source / Purification Polyclonal antibodies are produced by immunizing animals with a synthetic peptide corresponding to residues surrounding Phe300 of human APBA2 protein. Antibodies are purified by protein A and peptide affinity chromatography. Background Amyloid β A4 precursor protein-binding family A member 2 (APBA2) is a neuronal adaptor protein that interacts with the amyloid β precursor protein (APP) (1). The amyloid β-protein (Aβ) is the principal component of amyloid plaques, a pathological hallmark of Alzheimer’s disease (2). APBA2 has been shown to stabilize APP metabolism and suppress the secretion of Aβ (3). APBA2 mediates interaction between APP and the neural type I membrane protein Alcadein (Alc) by linking their cytoplasmic domains, thereby forming a tripartite complex of the three proteins in neurons (4).
    [Show full text]
  • Accurate Breakpoint Mapping in Apparently Balanced Translocation Families with Discordant Phenotypes Using Whole Genome Mate-Pair Sequencing
    Accurate Breakpoint Mapping in Apparently Balanced Translocation Families with Discordant Phenotypes Using Whole Genome Mate-Pair Sequencing Aristidou, Constantia; Koufaris, Costas; Theodosiou, Athina; Bak, Mads; Mehrjouy, Mana M; Behjati, Farkhondeh; Tanteles, George; Christophidou-Anastasiadou, Violetta; Tommerup, Niels; Sismani, Carolina Published in: PLOS ONE DOI: 10.1371/journal.pone.0169935 Publication date: 2017 Document version Publisher's PDF, also known as Version of record Document license: CC BY Citation for published version (APA): Aristidou, C., Koufaris, C., Theodosiou, A., Bak, M., Mehrjouy, M. M., Behjati, F., Tanteles, G., Christophidou- Anastasiadou, V., Tommerup, N., & Sismani, C. (2017). Accurate Breakpoint Mapping in Apparently Balanced Translocation Families with Discordant Phenotypes Using Whole Genome Mate-Pair Sequencing. PLOS ONE, 12(1), [e0169935]. https://doi.org/10.1371/journal.pone.0169935 Download date: 29. sep.. 2021 RESEARCH ARTICLE Accurate Breakpoint Mapping in Apparently Balanced Translocation Families with Discordant Phenotypes Using Whole Genome Mate-Pair Sequencing Constantia Aristidou1,2, Costas Koufaris1, Athina Theodosiou1, Mads Bak3, Mana M. Mehrjouy3, Farkhondeh Behjati4, George Tanteles5, Violetta Christophidou- Anastasiadou6, Niels Tommerup3, Carolina Sismani1,2* a1111111111 a1111111111 1 Department of Cytogenetics and Genomics, The Cyprus Institute of Neurology and Genetics, Nicosia, Cyprus, 2 The Cyprus School of Molecular Medicine, The Cyprus Institute of Neurology and Genetics, a1111111111
    [Show full text]
  • Supplemental Information
    Supplemental information Dissection of the genomic structure of the miR-183/96/182 gene. Previously, we showed that the miR-183/96/182 cluster is an intergenic miRNA cluster, located in a ~60-kb interval between the genes encoding nuclear respiratory factor-1 (Nrf1) and ubiquitin-conjugating enzyme E2H (Ube2h) on mouse chr6qA3.3 (1). To start to uncover the genomic structure of the miR- 183/96/182 gene, we first studied genomic features around miR-183/96/182 in the UCSC genome browser (http://genome.UCSC.edu/), and identified two CpG islands 3.4-6.5 kb 5’ of pre-miR-183, the most 5’ miRNA of the cluster (Fig. 1A; Fig. S1 and Seq. S1). A cDNA clone, AK044220, located at 3.2-4.6 kb 5’ to pre-miR-183, encompasses the second CpG island (Fig. 1A; Fig. S1). We hypothesized that this cDNA clone was derived from 5’ exon(s) of the primary transcript of the miR-183/96/182 gene, as CpG islands are often associated with promoters (2). Supporting this hypothesis, multiple expressed sequences detected by gene-trap clones, including clone D016D06 (3, 4), were co-localized with the cDNA clone AK044220 (Fig. 1A; Fig. S1). Clone D016D06, deposited by the German GeneTrap Consortium (GGTC) (http://tikus.gsf.de) (3, 4), was derived from insertion of a retroviral construct, rFlpROSAβgeo in 129S2 ES cells (Fig. 1A and C). The rFlpROSAβgeo construct carries a promoterless reporter gene, the β−geo cassette - an in-frame fusion of the β-galactosidase and neomycin resistance (Neor) gene (5), with a splicing acceptor (SA) immediately upstream, and a polyA signal downstream of the β−geo cassette (Fig.
    [Show full text]