Private Sector Engagement in Post-Conflict Yemen
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
United Nations Educational, Scientific and Cultural Organization (UNESCO)
United Nations Educational, Scientific and Cultural Organization UNESCO 2016 Cover The recent large-scale, systematic destruction and looting of cultural heritage has been the dominant theme at UNESCO throughout 2016. One of the Organization’s responses to these attacks on cultural heritage and cultural pluralism is the #Unite4Heritage campaign, a global movement that calls on everyone to harvest the power of culture to bring people together and to celebrate the places, objects and cultural traditions that make the world such a rich and vibrant place. This image produced for the campaign combines past and present, with the head of Buddha Shakyamuni and the face of an Erbore tribe warrior from Ethiopia. © Public Domain LACMA - Los Angeles County Museum of Art/Rod Waddington Published in 2017 by the United Nations Educational, Scientific and Cultural Organization (UNESCO). 7, place de Fontenoy, 75352 Paris 07 SP, France © UNESCO 2017 This publication is available in Open Access under the Attribution-ShareAlike 3.0 IGO (CC-BY-SA 3.0 IGO) license (http://creativecommons.org/licenses/by-sa/3.0/igo/). The present license applies exclusively to the text content of this publication and to images whose copyright belongs to UNESCO. By using the content of this publication, the users accept to be bound by the terms of use of the UNESCO Open Access Repository (http://www.unesco.org/open-access/terms-use-ccbysa-en). The designations employed and the presentation of material throughout this publication do not imply the expression of any opinion whatsoever on the part of UNESCO concerning the legal status of any country, territory, city or area or of its authorities, or concerning the delimitation of its frontiers or boundaries. -
Assessment of the Impact of Trade Policy Reform in Countries Acceding
UNITED NATIONS CONFERENCE ON TRADE AND DEVELOPMENT AASSESSMENT OF THE IIMPACT OF TTRADE PPOLICY RREFORM IN CCOUNTRIES AACCEDING TO THE WWORLD TTRADE OORGANIZATION:: TTHE GGENDER DDIMENSION A STUDY PREPARED UNDER THE UNCTAD TRUST FUND FOR WTO ACCESSIONS, PHASE 3 United Nations New York and Geneva, 2010 ASSESSMENT OF THE IMPACT OF TRADE POLICY REFORM IN COUNTIRES ACCEDING TO THE WTO: THE GENDER DIMENSION NNNOOOTTTEEE • The symbols of United Nations documents are composed of capital letters combined with figures. Mention of such a symbol indicates a reference to a United Nations document. • The views expressed in this volume are those of the authors and do not necessarily reflect the views of the UNCTAD secretariat or its member States. The designations employed and the presentation of the material do not imply the expression of any opinion whatsoever on the part of the United Nations Secretariat concerning the legal status of any country, territory, city or area, or of its authorities, or concerning the delimitation of its frontiers or boundaries, or regarding its economic system or degree of development. • Material in this publication may be freely quoted or reprinted, but acknowledgement is requested, together with a reference to the document number. A copy of the publication containing the quotation or reprint should be sent to the UNCTAD secretariat at: Palais des Nations, 1211 Geneva 10, Switzerland. Series Editor: Ms. Mina Mashayekhi Head, Trade Negotiations and Commercial Diplomacy Branch Division on International Trade in Goods and Services, and Commodities United Nations Conference on Trade and Development Palais des Nations CH-1211 Geneva 10 UNCTAD/DITC/TNCD/2010/6 UNITED NATIONS PUBLICATION ISSN 1816-2878 ii ACKNOWLEDGEMENTS AAACCCKKKNNNOOOWWWLLLEEEDDDGGGEEEMMMEEENNNTTTSSS This study was undertaken under the framework of the UNCTAD Trust Fund for WTO Accessions, Phase 3. -
Impact of COVID 19 on the Yemeni Economy: How the Drop in Remittances Affected Economic Sectors, Food Systems, and Households
REGIONAL PROGRAM POLICY NOTE 15 FEBRUARY 2021 Impact of COVID-19 on the Yemeni Economy How the drop in remittances affected economic sectors, food systems, and households Dalia Elsabbagh, Sikandra Kurdi, and Manfred Wiebelt There has been an unprecedented decline in the flow of remittances to Yemen – a vital source of money for millions – as a result of the COVID-19 pandemic. A Social Accounting Matrix (SAM) multiplier model of Yemen’s economy was used to estimate the impact of lower remittances on economic sectors and employment, food systems, and household incomes. Some of the key findings from this modeling exercise are: • National GDP is estimated to have fallen by 8.5 percent. • Agriculture was hardest hit, seeing an estimated drop in output of more than 9 percent. Food systems in Yemen are estimated to have experienced a reduction in output by almost 10 percent. • Employment losses were estimated at 8 percent, mainly due to job losses in services, followed by agriculture. • Household income fell on average by 12.5 percent, mainly driven by lower remittances but also as a result of lower factor earnings in the service sector and the agri-food system. Options for local recovery measures are limited. Nonetheless, Saudi Arabia and other Gulf countries could enact concrete policies to help Yemeni migrant workers survive the adverse impacts of COVID-19 in their labor markets. Since the start of the conflict in 2015, Yemen has experienced economic devastation. By the end of 2019, the loss of real GDP reached approximately 45 percent, estimated to be around 66 billion US dollars by the Yemeni Ministry of Planning (MPIC 2019). -
2018 DG Report on the Safety of Journalists and the Danger of Impunity
CI-18/COUNCIL-31/6/REV 2 2018 DG Report on the Safety of Journalists and the Danger of Impunity INTRODUCTION This report is submitted to the Intergovernmental Council of the International Programme for the Development of Communication (IPDC) in line with the Decision on the Safety of Journalists and the issue of Impunity adopted by the Council at its 26th session on 27 March 2008, and renewed at subsequent sessions in 2010, 2012, 2014 and 2016. In its latest Decision, adopted in November 2016, the IPDC Council urged Member States to “continue to inform the Director-General of UNESCO, on a voluntary basis, on the status of the judicial inquiries conducted on each of the killings condemned by the Director-General”. The present report provides an analysis of the cases of killings of journalists and associated media personnel that were condemned by the Director-General in 2016 and 2017. It also takes stock of the status of judicial enquiries conducted on each of the killings recorded by UNESCO between 2006 and 2017, based on information provided by Member States. TABLE OF CONTENTS 1. Executive Summary 2 2. Background and Context 2 3. Journalists’ killings in 2016 and 2017: key findings 7 3.1 Most dangerous regions 8 3.2 Rise in number of women journalists among fatalities 9 3.3 Highest number of killings among TV journalists 11 3.4 Majority of victims are local journalists 11 3.5 Freelance and staff journalists 12 3.6 More killings occurring in countries with no armed conflict 12 4. Member States’ responses: status of the judicial enquiries on cases of journalists killed from 2006 to end 2017 13 4.1 Decrease in Member State response rate to Director-General’s request 18 4.2 Slight reduction in impunity rate, but 89% of cases remain unresolved 19 4.3 Member States reporting on measures to promote safety of journalists and to combat impunity 22 5. -
Global Journal of Human Social Science
Online ISSN : 2249-460X Print ISSN : 0975-587X DOI : 10.17406/GJHSS EffectonImprovingtheEconomy EffectivenessofGovernmentPolicies FeasibilityoftheProposedMonetary RetrospectiveReflectionontheHistory VOLUME18ISSUE5VERSION1.0 Global Journal of Human-Social Science: E Economics Global Journal of Human-Social Science: E Economics Volume 18 Issue 5 (Ver. 1.0) Open Association of Research Society Global Journals Inc. *OREDO-RXUQDORI+XPDQ (A Delaware USA Incorporation with “Good Standing”; Reg. Number: 0423089) Social Sciences. 2018. Sponsors:Open Association of Research Society Open Scientific Standards $OOULJKWVUHVHUYHG 7KLVLVDVSHFLDOLVVXHSXEOLVKHGLQYHUVLRQ Publisher’s Headquarters office RI³*OREDO-RXUQDORI+XPDQ6RFLDO 6FLHQFHV´%\*OREDO-RXUQDOV,QF Global Journals ® Headquarters $OODUWLFOHVDUHRSHQDFFHVVDUWLFOHVGLVWULEXWHG XQGHU³*OREDO-RXUQDORI+XPDQ6RFLDO 945th Concord Streets, 6FLHQFHV´ Framingham Massachusetts Pin: 01701, 5HDGLQJ/LFHQVHZKLFKSHUPLWVUHVWULFWHGXVH United States of America (QWLUHFRQWHQWVDUHFRS\ULJKWE\RI³*OREDO -RXUQDORI+XPDQ6RFLDO6FLHQFHV´XQOHVV USA Toll Free: +001-888-839-7392 RWKHUZLVHQRWHGRQVSHFLILFDUWLFOHV USA Toll Free Fax: +001-888-839-7392 1RSDUWRIWKLVSXEOLFDWLRQPD\EHUHSURGXFHG Offset Typesetting RUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQV HOHFWURQLFRUPHFKDQLFDOLQFOXGLQJ SKRWRFRS\UHFRUGLQJRUDQ\LQIRUPDWLRQ G lobal Journals Incorporated VWRUDJHDQGUHWULHYDOV\VWHPZLWKRXWZULWWHQ 2nd, Lansdowne, Lansdowne Rd., Croydon-Surrey, SHUPLVVLRQ Pin: CR9 2ER, United Kingdom 7KHRSLQLRQVDQGVWDWHPHQWVPDGHLQWKLV ERRNDUHWKRVHRIWKHDXWKRUVFRQFHUQHG 8OWUDFXOWXUHKDVQRWYHULILHGDQGQHLWKHU -
S/PV.8348 the Situation in the Middle East 11/09/2018
United Nations S/ PV.8348 Security Council Provisional Seventy-third year 8348th meeting Tuesday, 11 September 2018, 3 p.m. New York President: Mrs. Haley ..................................... (United States of America) Members: Bolivia (Plurinational State of) ..................... Mrs. Cordova Soria China ......................................... Mr. Wu Haitao Côte d’Ivoire ................................... Mr. Ipo Equatorial Guinea ............................... Mr. Esono Mbengono Ethiopia ....................................... Ms. Guadey France ........................................ Mr. Delattre Kazakhstan .................................... Mr. Tumysh Kuwait ........................................ Mr. Alotaibi Netherlands .................................... Mr. Van Oosterom Peru .......................................... Mr. Meza-Cuadra Poland ........................................ Ms. Wronecka Russian Federation ............................... Mr. Nebenzia Sweden ....................................... Mr. Skoog United Kingdom of Great Britain and Northern Ireland .. Ms. Pierce Agenda The situation in the Middle East This record contains the text of speeches delivered in English and of the translation of speeches delivered in other languages. The final text will be printed in the Official Records of the Security Council. Corrections should be submitted to the original languages only. They should be incorporated in a copy of the record and sent under the signature of a member of the delegation concerned to the Chief of the Verbatim Reporting Service, room U-0506 ([email protected]). Corrected records will be reissued electronically on the Official Document System of the United Nations (http://documents.un.org). 18-28204 (E) *1828204* S/PV.8348 The situation in the Middle East 11/09/2018 The meeting was called to order at 3.10 p.m. to call for formal consultations that would lead to a resumption of the political process. Indeed, I had Adoption of the agenda the honour of being with the Council on 2 August to The agenda was adopted. -
Demographic and Labour Market Trends in Yemen
DEMOGRAPHIC AND LABOUR MARKET TRENDS IN YEMEN A BACKGROUND PAPER TO FRAME THE INTERFACE BETWEEN THE YOUTH EMPLOYMENT CHALLENGE AND THE NATIONAL MIGRATION POLICY Michele Bruni Andrea Salvini Lara Uhlenhaut International Labour Organization Regional Office for Arab Sates Copyright © International Labour Organization 2014 First published 2014 Publications of the International Labour Office enjoy copyright under Protocol 2 of the Universal Copyright Convention. Nevertheless, short excerpts from them may be reproduced without authorization, on condition that the source is indicated. For rights of reproduction or translation, application should be made to ILO Publications (Rights and Permissions), International Labour Office, CH-1211 Geneva 22, Switzerland, or by email: [email protected]. The International Labour Office welcomes such applications. Libraries, institutions and other users registered with reproduction rights organizations may make copies in accordance with the licences issued to them for this purpose. Visit www.ifrro.org to find the reproduction rights organization in your country. ILO Cataloguing in Publication Data Bruni, Michele; Salvini, Andrea; Uhlenhaut, Lara Demographic and labour market trends in Yemen : a background paper to frame the interface between the youth employment challenge and the national migration policy / Michele Bruni, Andrea Salvini, Lara Uhlenhaut ; International Labour Organization, ILO Regional Office for the Arab States. - Beirut: ILO, 2014 ISBN: 9789221291046; 9789221291053 (web pdf) International Labour -
Introduction to the Macroeconomic Structure of Yemen
Munich Personal RePEc Archive Introduction to the Macroeconomic Structure of Yemen Mohamed, Issam A.W. Department of Economics, Al Neelain University, Khartoum, Sudan 2011 Online at https://mpra.ub.uni-muenchen.de/31782/ MPRA Paper No. 31782, posted 23 Jun 2011 09:28 UTC Introduction to the Macroeconomic Structure of Yemen Professor Dr. Issam A.W. Mohamed1 1. Abstract................................................................................................................ 1 2. The Economic Activity......................................................................................... 1 3. Macroeconomic Variables .................................................................................... 2 4. High Employment, Low Unemployment............................................................... 3 5. International Trade ............................................................................................... 4 6. Aggregate Supply And Demand ........................................................................... 5 7. Dynamic Economics............................................................................................. 6 8. Macroeconomic Of Yemen................................................................................... 7 9. The Structure And Features Of The Yemeni Economy ....................................... 12 10. Foreign Trade................................................................................................... 14 11. Balance Of Payments....................................................................................... -
Republic of Yemen NATIONAL REPORT
Republic of Yemen Republic of Yemen NATIONAL REPORT Third United Nations Conference on Housing and Sustainable Urban Development - HABITAT III - 2016, Quito/ Ecuador Contents Contents .................................................................................................................................................. 1 Introduction ............................................................................................................................................ 3 Acknowledgments ................................................................................................................................... 4 Abbreviations .......................................................................................................................................... 5 I. Urban Demographic Issues and Challenges ......................................................................................... 7 1. Managing rapid urbanization .......................................................................................................... 7 2. Managing rural‐urban linkages ....................................................................................................... 8 3. Addressing urban youth needs ....................................................................................................... 9 4. Responding to the needs of the aged ........................................................................................... 11 5. Integrating gender in urban development ................................................................................... -
BBG 2016 Annual Report
2016 Annual Report The Broadcasting Board of Governors is the independent federal government agency that oversees all U.S. civilian international media. BBG is also the name of the board that governs the agency. The five networks of the BBG are trusted news sources, providing high-quality journalism and programming to more than 278 million people each week. BBG networks are news leaders, covering stories left untold in environments that lack press freedom and fostering civil dialogue in places overwhelmed with disinformation. They are leading channels for information about the United States as well as independent platforms for freedom of expression and a free press. Table of Contents 2016: A Year of Impact and Transformation Letter from the CEO ...........................................................................3 Mission ............................................................................................4 A Shared Vision .................................................................................6 Leadership Guides Strategy and Organizational Changes .......................8 Year in Review ................................................................................. 10 Getting Results................................................................................ 14 A Challenging World Press & Internet Freedom Under Attack ............................................. 16 Threats to BBG Journalists ................................................................ 18 Strategic Priorities Strategic Priorities Overview.............................................................22 -
Conflict in Yemen Subject Specialist: Ben Smith
DEBATE PACK Number CDP - 2016/0032 | 1 February 2016 Tim Robinson Conflict in Yemen Subject specialist: Ben Smith Contents Backbench Business Committee Debate 1. Summary 2 Chamber 2. Press Articles 3 4 February 2016 3. Gov.uk 5 Initiated by Kirsten Oswald, Flick Drummond, Keith Vaz, Edward Argar and Steven Paterson 4. PQs 7 5. Debates 28 6. Early Day Motions 32 7. Petition 35 8. Further reading 37 Map courtesy of University of Texas The proceeding of this debate may be viewed on parliamentlive.tv The House of Commons Library prepares a briefing in hard copy and/or online for most non-legislative debates in the Chamber and Westminster Hall other than half-hour debates. Debate Packs are produced quickly after the announcement of parliamentary business. They are intended to provide a summary or overview of the issue being debated and identify relevant briefings and useful documents, including press and parliamentary material. More detailed briefing can be prepared for Members on request to the Library. www.parliament.uk/commons-library | intranet.parliament.uk/commons-library | [email protected] | @commonslibrary 2 Number CDP - 2016/0032, 1 February 2016 1. Summary President Ali Abdallah Saleh had been in power since 1978, an experience that he famously likened to “dancing on the heads of snakes.” As the position of Saleh became increasingly precarious, Saudi Arabia was one of the leaders in brokering a deal for a transition. The deal, backed by the UN, involved a transfer of power to Saleh’s deputy, Abd- Rabbu Mansour Hadi, which finally took place in November 2011 after months of deadly clashes between protesters and the security forces. -
The Mineral Industry of Yemen in 2007
2007 Minerals Yearbook YEMEN U.S. Department of the Interior March 2010 U.S. Geological Survey THE MINERAL INDUS T RY OF YE M EN By Philip M. Mobbs The production of hydrocarbons formed a significant Commodity Review segment of the economy of Yemen. The oil sector accounted for 92% of total merchandise exports, 75% of Government Metals revenue, and about 11% of the country’s gross domestic product in 2006 (the latest year for which data were available) Cobalt, Copper, and Nickel.—Cantex Mine Development (van Rooden and others, 2007, p. 3, 11, 23). Corp. of Canada completed an 11-hole drilling program at the Mineral and energy resources were owned by the state, Wadi Qutabah prospect and started a 17-hole drill program according to Article 8 of the Constitution. Metal and industrial at the Suwar project in 2007. Cantex planned to complete a mineral exploration and production operations were governed prefeasibility study of the Suwar project by mid-2010. by the Mines and Quarries law No. 24 of 2002. Mineral Zinc.—Jabal Salab Co. Ltd., which was owned by ZincOx projects also were subject to the provisions of the Investment Resources plc of the United Kingdom (52% interest) and Ansan law No. 22 of 2002. In 2007, the International Finance Corp., Wikfs Investments Ltd. (48%), continued the development of which was an affiliate of the World Bank, and the Ministry the Jabaili zinc deposit, which was located about 110 kilometers of Oil and Minerals of Yemen jointly continued work on the (km) northeast of Sana’a. Construction of the Jabaili Mine and development of a national mining policy.