DOCSLIB.ORG

Arl6ip5 (NM 023972) Rat Tagged ORF Clone – RR209107 | Origene

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Arl6ip5 (NM 023972) Rat Tagged ORF Clone – RR209107 | Origene OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RR209107 Arl6ip5 (NM_023972) Rat Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Arl6ip5 (NM_023972) Rat Tagged ORF Clone Tag: Myc-DDK Symbol: Arl6ip5 Synonyms: Gtrap3-18 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RR209107 representing NM_023972 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGACGTGAACCTTGCCCCGCTCCGTGCCTGGGATGATTTCTTCCCGGGCTCTGATCGTTTCGCACGGC CGGACTTCAGGGATATATCCAAATGGAACAACCGTGTAGTGAGCAATCTGCTCTATTACCAGACCAACTA CCTGGTGGTGGCTGCCATGATGATTTCAGTCGTTGGGTTTCTGAGCCCCTTCAACATGATCCTTGGAGGA ATCATTGTGGTGCTGGTGTTCACGGGGTTTGTGTGGGCAGCACACAATAAAGACATCCTCCGCCGGATGA AGAAGCAGTACCCAACGGCCTTTGTCATGGTGGTCATGCTAGCCAGCTACTTCCTCATATCCATGTTTGG GGGTGTCATGGTCTTTGTGTTTGGCATCACGTTTCCCTTATTGTTGATGTTCATCCATGCATCCCTGAGA CTTCGAAACCTCAAGAACAAACTGGAAAATAAAATGGAGGGAATAGGCTTGAAGAAAACGCCGATGGGCA TCATCCTGGATGCCTTGGAACAGCAGGAAGACAGCATCAATAAATTTGCTGACTACATCAGCAAAGCCAG GGAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RR209107 representing NM_023972 Red=Cloning site Green=Tags(s) MDVNLAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISVVGFLSPFNMILGG IIVVLVFTGFVWAAHNKDILRRMKKQYPTAFVMVVMLASYFLISMFGGVMVFVFGITFPLLLMFIHASLR LRNLKNKLENKMEGIGLKKTPMGIILDALEQQEDSINKFADYISKARE myc-FLAG tag Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 Arl6ip5 (NM_023972) Rat Tagged ORF Clone – RR209107 Cloning Scheme: Plasmid Map: ACCN: NM_023972 ORF Size: 564 bp OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_023972.3, NP_076462.1 RefSeq Size: 567 bp This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 Arl6ip5 (NM_023972) Rat Tagged ORF Clone – RR209107 RefSeq ORF: 567 bp Locus ID: 66028 UniProt ID: Q9ES40 MW: 21.5 kDa Gene Summary: modifies glutamate transporter EAAC1 function by lowering EAAC1 substrate affinity; regulates glutamate transport [RGD, Feb 2006] This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.
Load more

Recommended publications
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • 1) (As of December 2018) and the Latest GWAS of AD (2
    SUPPLEMENTARY FIGURES downstream intergenic ncRNA_exonic upstream ●936 ●918 group downstream intergenic ncRNA_exonic upstream group exonic exonicintronicintronic ncRNA_intronic ncRNA_intronicUTR3 UTR3 3.8% 1.2%1.5%1.9% 3.8% 5.4%5.4% 750 0.3% 3.8%1.2%1.5%1.9% ●700 5.4% ●670 0.3% 500 45.8% 40.240.2% % 45.8% ●329 ●274 250 ●223 Number (GWAS SNPs/studies) Number (GWAS ●128 ●105 45.8% ●54 ●57 ●58 ●48 ●42 ●46 ●50 ●30 ●3740.2% ● ●17 ●25 ●4 ●6 ●12 0 ● 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 2017 2018 2019 Year Supplementary Figure S1. GWAS of AD since 2007. The figure is based on data from the GWAS Catalog (1) (as of December 2018) and the latest GWAS of AD (2). The green area shows the total number of AD-associated SNPs, and the purple area shows the total number of GWAS of AD. The insert chart shows the proportions of different types of all 936 AD-associated SNPs. 1 100 200 RPS27A TGFB2 BIN1 C4BPB MSH2 PROC UGT1A1 RAB1A TTN DISC1 50 PDCL3 COL4A3 CD55 ERCC3 100 USP21 C4BPA ITSN2 PTPRF MPZ FMN2 INPP5D CEP85 FNBP1L CSF1 CD46 ADAMTS4 PRKRA SPRED2 0 CTNNA2 DGKD ADCY10 ZAP70 LIMS2 PDE1A PROX1 0 CHRNB2 CR1 HSPG2 SH3BGRL3 DAB1 CTBS FCER1G MAP3K2 AD risk score or log10(P value) IL6R CDC73 CD34 AD risk score or log10(P value) −50 B4GALT3 IL19 0 50 100 150 200 250 0 50 100 150 200 Chromosome 1 (Mb) Chromosome 2 (Mb) ATP2B2 LTF ARF4 MECOM PAK2 EPHB1 40 VHL PRSS42 ARL6IP5 150 COL25A1 TDGF1 RPSA CCR2 CCR1 IL1RAP IRAK2 20 PTPRG 100 FLNB TF CX3CR1 IL17RD SH3RF1 FGG FANCD2 LIMD1 CCR5 50 0 WDR1 PDGFRA EIF4E FGB AD risk score or log10(P value) AD risk
    [Show full text]
  • Aneuploidy: Using Genetic Instability to Preserve a Haploid Genome?
    Health Science Campus FINAL APPROVAL OF DISSERTATION Doctor of Philosophy in Biomedical Science (Cancer Biology) Aneuploidy: Using genetic instability to preserve a haploid genome? Submitted by: Ramona Ramdath In partial fulfillment of the requirements for the degree of Doctor of Philosophy in Biomedical Science Examination Committee Signature/Date Major Advisor: David Allison, M.D., Ph.D. Academic James Trempe, Ph.D. Advisory Committee: David Giovanucci, Ph.D. Randall Ruch, Ph.D. Ronald Mellgren, Ph.D. Senior Associate Dean College of Graduate Studies Michael S. Bisesi, Ph.D. Date of Defense: April 10, 2009 Aneuploidy: Using genetic instability to preserve a haploid genome? Ramona Ramdath University of Toledo, Health Science Campus 2009 Dedication I dedicate this dissertation to my grandfather who died of lung cancer two years ago, but who always instilled in us the value and importance of education. And to my mom and sister, both of whom have been pillars of support and stimulating conversations. To my sister, Rehanna, especially- I hope this inspires you to achieve all that you want to in life, academically and otherwise. ii Acknowledgements As we go through these academic journeys, there are so many along the way that make an impact not only on our work, but on our lives as well, and I would like to say a heartfelt thank you to all of those people: My Committee members- Dr. James Trempe, Dr. David Giovanucchi, Dr. Ronald Mellgren and Dr. Randall Ruch for their guidance, suggestions, support and confidence in me. My major advisor- Dr. David Allison, for his constructive criticism and positive reinforcement.
    [Show full text]
  • RNA Sequencing of Whole Blood in Discordant Twin and Case-Controlled Cohorts
    Biomarker Discovery in Attention Decit Hyperactivity Disorder: RNA sequencing of Whole Blood in Discordant Twin and Case-Controlled Cohorts Timothy A. McCaffrey ( [email protected] ) George Washington University Medical Center https://orcid.org/0000-0002-4648-7833 Georges St. Laurent III The St. Laurent Institute Dmitry Shtokalo Institut sistem informatiki imeni A P Ersova SO RAN Denis Antonets A P Ershov Institute of Informatics Systems SB RAS: Institut sistem informatiki imeni A P Ersova SO RAN Yuri Vyatkin Janssen Research and Development LLC Daniel Jones Amgen Inc Eleanor Battison Oregon Health & Science University - West Campus Joel T. Nigg Oregon Health & Science University Research article Keywords: attention-decit/hyperactivity disorder (ADHD), RNA sequencing, transcriptome, GIT1, galactose, twins Posted Date: October 22nd, 2020 DOI: https://doi.org/10.21203/rs.3.rs-20756/v3 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Page 1/34 Version of Record: A version of this preprint was published on October 28th, 2020. See the published version at https://doi.org/10.1186/s12920-020-00808-8. Page 2/34 Abstract Background: A variety of DNA-based methods have been applied to identify genetic markers of attention decit hyperactivity disorder (ADHD), but the connection to RNA-based gene expression has not been fully exploited. Methods: Using well dened cohorts of discordant, monozygotic twins from the Michigan State University Twin Registry, and case-controlled ADHD cases in adolescents, the present studies utilized advanced single molecule RNA sequencing to identify expressed changes in whole blood RNA in ADHD. Multiple analytical strategies were employed to narrow differentially expressed RNA targets to a small set of potential biomarkers of ADHD.
    [Show full text]
  • Genetic Research
    Genetic Research Who Is At Risk for Alcoholism? Tatiana Foroud, Ph.D.; Howard J. Edenberg, Ph.D.; and John C. Crabbe, Ph.D. The National Institute on Alcohol Abuse and Alcoholism (NIAAA) was founded 40 years ago to help elucidate the biological underpinnings of alcohol dependence, including the potential contribution of genetic factors. Twin, adoption, and family studies conclusively demonstrated that genetic factors account for 50 to 60 percent of the variance in risk for developing alcoholism. Case–control studies and linkage analyses have helped identify DNA variants that contribute to increased risk, and the NIAAA­sponsored Collaborative Studies on Genetics of Alcoholism (COGA) has the expressed goal of identifying contributing genes using state­of­the­art genetic technologies. These efforts have ascertained several genes that may contribute to an increased risk of alcoholism, including certain variants encoding alcohol­metabolizing enzymes and neurotransmitter receptors. Genome­wide association studies allowing the analysis of millions of genetic markers located throughout the genome will enable discovery of further candidate genes. In addition to these human studies, genetic animal models of alcohol’s effects and alcohol use have greatly advanced our understanding of the genetic basis of alcoholism, resulting in the identification of quantitative trait loci and allowing for targeted manipulation of candidate genes. Novel research approaches—for example, into epigenetic mechanisms of gene regulation—also are under way and undoubtedly
    [Show full text]
  • LSCC SNP Variant Regulates SOX2 Modulation of VDAC3
    www.oncotarget.com Oncotarget, 2018, Vol. 9, (No. 32), pp: 22340-22352 Research Paper LSCC SNP variant regulates SOX2 modulation of VDAC3 Jacqueline Chyr1,3, Dongmin Guo2 and Xiaobo Zhou2,3 1Department of Cancer Biology, Wake Forest School of Medicine, Winston-Salem, NC 27157, USA 2Center for Bioinformatics and Systems Biology, Department of Radiology, Wake Forest School of Medicine, Winston-Salem, NC 27157, USA 3School of Biomedical Informatics, University of Texas Health Science Center at Houston, Houston, TX 77030, USA Correspondence to: Xiaobo Zhou, email: [email protected] Keywords: lung cancer; SOX2; eQTL; SNP; topologically associating domain Received: June 21, 2017 Accepted: February 28, 2018 Published: April 27, 2018 Copyright: Chyr et al. This is an open-access article distributed under the terms of the Creative Commons Attribution License 3.0 (CC BY 3.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. ABSTRACT Lung squamous cell carcinoma (LSCC) is a genomically complex malignancy with no effective treatments. Recent studies have found a large number of DNA alterations such as SOX2 amplification in LSCC patients. As a stem cell transcription factor, SOX2 is important for the maintenance of pluripotent cells and may play a role in cancer. To study the downstream mechanisms of SOX2, we employed expression quantitative trait loci (eQTLs) technology to investigate how the presence of SOX2 affects the expression of target genes. We discovered unique eQTLs, such as rs798827-VDAC3 (FDR p-value = 0.0034), that are only found in SOX2-active patients but not in SOX2- inactive patients.
    [Show full text]
  • Genetic Analysis of Ethanol Sensitivity and Tolerance in Drosophila
    Virginia Commonwealth University VCU Scholars Compass Theses and Dissertations Graduate School 2013 Genetic Analysis of Ethanol Sensitivity and Tolerance in Drosophila Robin Chan Virginia Commonwealth University Follow this and additional works at: https://scholarscompass.vcu.edu/etd Part of the Medical Genetics Commons © The Author Downloaded from https://scholarscompass.vcu.edu/etd/3154 This Thesis is brought to you for free and open access by the Graduate School at VCU Scholars Compass. It has been accepted for inclusion in Theses and Dissertations by an authorized administrator of VCU Scholars Compass. For more information, please contact [email protected]. Title Page GENETIC ANALYSIS OF ETHANOL SENSITIVITY AND TOLERANCE IN DROSOPHILA A Thesis Submitted in Partial Fulfillment of the Requirements for the Degree of Master of Science at Virginia Commonwealth University. by Robin F. Chan B.S., James Madison University, 2009 Advisor: Mike S. Grotewiel, Ph.D. Dept. of Human and Molecular Genetics Virginia Commonwealth University Richmond, Virginia July 2013 Abstract Genetic Analysis of Ethanol Sensitivity and Tolerance in Drosophila By Robin F. Chan, B.S. A Thesis Submitted in Partial Fulfillment of the Requirements for the Degree of Master of Science at Virginia Commonwealth University. Virginia Commonwealth University, 2013 Advisor: Mike S. Grotewiel, Ph.D. - Dept. Human and Molecular Genetics The genetic pathways influencing alcohol abuse and dependence are poorly characterized. Many critical discoveries about the interactions between ethanol-related behaviors and genetics have been made in the fruit fly Drosophila melanogaster. Coupling the statistical power of model organism studies to human association studies bolsters the analytical efficacy of these genomic approaches.
    [Show full text]
  • Content Based Search in Gene Expression Databases and a Meta-Analysis of Host Responses to Infection
    Content Based Search in Gene Expression Databases and a Meta-analysis of Host Responses to Infection A Thesis Submitted to the Faculty of Drexel University by Francis X. Bell in partial fulfillment of the requirements for the degree of Doctor of Philosophy November 2015 c Copyright 2015 Francis X. Bell. All Rights Reserved. ii Acknowledgments I would like to acknowledge and thank my advisor, Dr. Ahmet Sacan. Without his advice, support, and patience I would not have been able to accomplish all that I have. I would also like to thank my committee members and the Biomed Faculty that have guided me. I would like to give a special thanks for the members of the bioinformatics lab, in particular the members of the Sacan lab: Rehman Qureshi, Daisy Heng Yang, April Chunyu Zhao, and Yiqian Zhou. Thank you for creating a pleasant and friendly environment in the lab. I give the members of my family my sincerest gratitude for all that they have done for me. I cannot begin to repay my parents for their sacrifices. I am eternally grateful for everything they have done. The support of my sisters and their encouragement gave me the strength to persevere to the end. iii Table of Contents LIST OF TABLES.......................................................................... vii LIST OF FIGURES ........................................................................ xiv ABSTRACT ................................................................................ xvii 1. A BRIEF INTRODUCTION TO GENE EXPRESSION............................. 1 1.1 Central Dogma of Molecular Biology........................................... 1 1.1.1 Basic Transfers .......................................................... 1 1.1.2 Uncommon Transfers ................................................... 3 1.2 Gene Expression ................................................................. 4 1.2.1 Estimating Gene Expression ............................................ 4 1.2.2 DNA Microarrays ......................................................
    [Show full text]
  • Whole Exome Sequencing of ENU-Induced Thrombosis Modifier
    bioRxiv preprint doi: https://doi.org/10.1101/174086; this version posted March 24, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 1 2 Whole exome sequencing of ENU-induced thrombosis modifier 3 mutations in the mouse 4 5 Short title: 6 Identifying thrombosis modifier genes 7 8 Kärt Tomberg1,#a, Randal J. Westrick2, Emilee N. Kotnik3,#b, David R Siemieniak3,4, 9 Guojing Zhu3, Thomas L. Saunders5,6, Audrey C. Cleuren3, and David Ginsburg1,3,4,5,7,* 10 11 1Department of Human Genetics, University of Michigan, Ann Arbor, Michigan, United 12 States of America 13 2Department of Biological Sciences and Center for Data Science and Big Data Analysis, 14 Oakland University, Rochester, Michigan, United States of America 15 3Life Sciences Institute, University of Michigan, Ann Arbor, Michigan, United States of 16 America 17 4Howard Hughes Medical Institute, University of Michigan, Ann Arbor, Michigan, United 18 States of America 19 5Departments of Internal Medicine, Division of Molecular Medicine and Genetics, 20 University of Michigan, Ann Arbor, Michigan, United States of America 21 6Transgenic Animal Model Core Laboratory, University of Michigan, Ann Arbor, 22 Michigan, United States of America bioRxiv preprint doi: https://doi.org/10.1101/174086; this version posted March 24, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity.
    [Show full text]
  • Identification of Acquired Copy Number Alterations and Uniparental
    Leukemia (2010) 24, 438–449 & 2010 Macmillan Publishers Limited All rights reserved 0887-6924/10 $32.00 www.nature.com/leu ORIGINAL ARTICLE Identification of acquired copy number alterations and uniparental disomies in cytogenetically normal acute myeloid leukemia using high-resolution single-nucleotide polymorphism analysis L Bullinger1,4, J Kro¨nke1,4, C Scho¨n1,4, I Radtke2, K Urlbauer1, U Botzenhardt1, V Gaidzik1, A Cario´ 1, C Senger1, RF Schlenk1, JR Downing2, K Holzmann3,KDo¨hner1 and H Do¨hner1 1Department of Internal Medicine III, University Hospital of Ulm, Ulm, Germany; 2Department of Pathology, St Jude Children’s Research Hospital, Memphis, TN, USA and 3Microarray Core Facility, University of Ulm, Ulm, Germany Recent advances in genome-wide single-nucleotide polymorph- tyrosine kinase 3 (FLT3) gene the CCAAT/enhancer binding ism (SNP) analyses have revealed previously unrecognized protein-a (CEBPA) gene, the myeloid-lymphoid or mixed-line- microdeletions and uniparental disomy (UPD) in a broad age leukemia (MLL) gene, the neuroblastoma RAS viral spectrum of human cancers. As acute myeloid leukemia (AML) represents a genetically heterogeneous disease, this oncogene homolog (NRAS) gene, the Wilms’ tumor 1 (WT1) technology might prove helpful, especially for cytogenetically gene, and the runt-related transcription factor 1 (RUNX1) 4,5 normal AML (CN-AML) cases. Thus, we performed high- gene. These aberrations underscore the genetic complexity resolution SNP analyses in 157 adult cases of CN-AML. Regions of CN-AML and many additional genetic lesions are expected to of acquired UPDs were identified in 12% of cases and in the be present in this subset of AML.
    [Show full text]
  • A Network Inference Approach to Understanding Musculoskeletal
    A NETWORK INFERENCE APPROACH TO UNDERSTANDING MUSCULOSKELETAL DISORDERS by NIL TURAN A thesis submitted to The University of Birmingham for the degree of Doctor of Philosophy College of Life and Environmental Sciences School of Biosciences The University of Birmingham June 2013 University of Birmingham Research Archive e-theses repository This unpublished thesis/dissertation is copyright of the author and/or third parties. The intellectual property rights of the author or third parties in respect of this work are as defined by The Copyright Designs and Patents Act 1988 or as modified by any successor legislation. Any use made of information contained in this thesis/dissertation must be in accordance with that legislation and must be properly acknowledged. Further distribution or reproduction in any format is prohibited without the permission of the copyright holder. ABSTRACT Musculoskeletal disorders are among the most important health problem affecting the quality of life and contributing to a high burden on healthcare systems worldwide. Understanding the molecular mechanisms underlying these disorders is crucial for the development of efficient treatments. In this thesis, musculoskeletal disorders including muscle wasting, bone loss and cartilage deformation have been studied using systems biology approaches. Muscle wasting occurring as a systemic effect in COPD patients has been investigated with an integrative network inference approach. This work has lead to a model describing the relationship between muscle molecular and physiological response to training and systemic inflammatory mediators. This model has shown for the first time that oxygen dependent changes in the expression of epigenetic modifiers and not chronic inflammation may be causally linked to muscle dysfunction.
    [Show full text]
  • Analyzing the Mirna-Gene Networks to Mine the Important Mirnas Under Skin of Human and Mouse
    Hindawi Publishing Corporation BioMed Research International Volume 2016, Article ID 5469371, 9 pages http://dx.doi.org/10.1155/2016/5469371 Research Article Analyzing the miRNA-Gene Networks to Mine the Important miRNAs under Skin of Human and Mouse Jianghong Wu,1,2,3,4,5 Husile Gong,1,2 Yongsheng Bai,5,6 and Wenguang Zhang1 1 College of Animal Science, Inner Mongolia Agricultural University, Hohhot 010018, China 2Inner Mongolia Academy of Agricultural & Animal Husbandry Sciences, Hohhot 010031, China 3Inner Mongolia Prataculture Research Center, Chinese Academy of Science, Hohhot 010031, China 4State Key Laboratory of Genetic Resources and Evolution, Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming 650223, China 5Department of Biology, Indiana State University, Terre Haute, IN 47809, USA 6The Center for Genomic Advocacy, Indiana State University, Terre Haute, IN 47809, USA Correspondence should be addressed to Yongsheng Bai; [email protected] and Wenguang Zhang; [email protected] Received 11 April 2016; Revised 15 July 2016; Accepted 27 July 2016 Academic Editor: Nicola Cirillo Copyright © 2016 Jianghong Wu et al. This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Genetic networks provide new mechanistic insights into the diversity of species morphology. In this study, we have integrated the MGI, GEO, and miRNA database to analyze the genetic regulatory networks under morphology difference of integument of humans and mice. We found that the gene expression network in the skin is highly divergent between human and mouse.
    [Show full text]