Arl6ip5 (NM 023972) Rat Tagged ORF Clone – RR209107 | Origene

Arl6ip5 (NM 023972) Rat Tagged ORF Clone – RR209107 | Origene

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RR209107 Arl6ip5 (NM_023972) Rat Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Arl6ip5 (NM_023972) Rat Tagged ORF Clone Tag: Myc-DDK Symbol: Arl6ip5 Synonyms: Gtrap3-18 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RR209107 representing NM_023972 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGACGTGAACCTTGCCCCGCTCCGTGCCTGGGATGATTTCTTCCCGGGCTCTGATCGTTTCGCACGGC CGGACTTCAGGGATATATCCAAATGGAACAACCGTGTAGTGAGCAATCTGCTCTATTACCAGACCAACTA CCTGGTGGTGGCTGCCATGATGATTTCAGTCGTTGGGTTTCTGAGCCCCTTCAACATGATCCTTGGAGGA ATCATTGTGGTGCTGGTGTTCACGGGGTTTGTGTGGGCAGCACACAATAAAGACATCCTCCGCCGGATGA AGAAGCAGTACCCAACGGCCTTTGTCATGGTGGTCATGCTAGCCAGCTACTTCCTCATATCCATGTTTGG GGGTGTCATGGTCTTTGTGTTTGGCATCACGTTTCCCTTATTGTTGATGTTCATCCATGCATCCCTGAGA CTTCGAAACCTCAAGAACAAACTGGAAAATAAAATGGAGGGAATAGGCTTGAAGAAAACGCCGATGGGCA TCATCCTGGATGCCTTGGAACAGCAGGAAGACAGCATCAATAAATTTGCTGACTACATCAGCAAAGCCAG GGAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RR209107 representing NM_023972 Red=Cloning site Green=Tags(s) MDVNLAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISVVGFLSPFNMILGG IIVVLVFTGFVWAAHNKDILRRMKKQYPTAFVMVVMLASYFLISMFGGVMVFVFGITFPLLLMFIHASLR LRNLKNKLENKMEGIGLKKTPMGIILDALEQQEDSINKFADYISKARE myc-FLAG tag Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 Arl6ip5 (NM_023972) Rat Tagged ORF Clone – RR209107 Cloning Scheme: Plasmid Map: ACCN: NM_023972 ORF Size: 564 bp OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_023972.3, NP_076462.1 RefSeq Size: 567 bp This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 Arl6ip5 (NM_023972) Rat Tagged ORF Clone – RR209107 RefSeq ORF: 567 bp Locus ID: 66028 UniProt ID: Q9ES40 MW: 21.5 kDa Gene Summary: modifies glutamate transporter EAAC1 function by lowering EAAC1 substrate affinity; regulates glutamate transport [RGD, Feb 2006] This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    3 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us