Probe Set Idgene Title Gene Symbolentrez Gene SNI Significant

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Probe Set IDGene Title Gene SymbolEntrez Gene SNI significantCCI contrastsignificantSNL contrast significant contrast X37.Naive.1X38.Naive.2X63.Naive.3X15.SNI.3d.1X16.SNI.3d.2X52.SNI.3d.3 AA108277_atheat shock protein 105 (predicted)Hsp105_predicted288444 1 0 0 5.549387 5.238558 5.178111 5.815298 5.943223 6.051545 AA685903_attumor rejection antigen gp96 (predicted)Tra1_predicted 362862 1 0 0 6.801538 6.71891 6.641233 6.830651 7.1481 7.347777 AA848268_atDnaJ (Hsp40) homolog, subfamilyDnaja4_predicted A, member 4 300721(predicted) 1 0 0 6.933897 6.407019 6.57398 6.502978 6.969781 7.355625 AA850219_atannexin A3 Anxa3 25291 1 0 1 5.265556 5.38959 5.432943 6.105834 6.043472 6.006547 AB008538_atactivated leukocyte cell adhesionAlcam molecule 79559 0 1 1 6.620458 6.176618 6.341639 6.452098 6.234426 6.272636 AB010119_g_att-complex testis expressed 1 Tctex1 83462 0 1 0 7.083978 6.968353 6.962344 6.854244 7.042128 6.778367 AB010436_atcadherin 8 Cdh8 84408 0 0 1 4.872389 4.488938 4.660215 4.484334 4.491808 4.595026 AB011679_attubulin, beta 5 Tubb5 29214 0 0 1 5.522309 5.393412 5.571733 5.560368 5.942396 5.806371 AB012234_atnuclear factor I/X Nfix 81524 0 1 0 8.116762 8.210814 8.211109 7.929804 7.881378 8.054843 AB012234_g_atnuclear factor I/X Nfix 81524 0 1 1 6.436642 6.743469 6.428728 6.359448 6.538127 6.655484 AB012235_atnuclear factor I/X Nfix 81524 0 1 1 5.818095 5.924009 5.664822 5.74087 5.729043 5.730496 AB013454_atSimilar to splicing variant of retinal--- degeneration498015 B beta 1 0 0 7.178391 7.072494 7.12695 6.465434 6.205107 6.104624 AB016160_atgamma-aminobutyric acid (GABA)Gabbr1 B receptor 1 81657 0 1 1 8.040785 7.821999 7.607107 7.946148 8.232319 7.89772 AB016160_g_atgamma-aminobutyric acid (GABA)Gabbr1 B receptor 1 81657 0 1 0 7.028447 6.886247 6.634395 7.056162 7.413483 7.140599 AB016161UTR#1_g_atgamma-aminobutyric acid (GABA)Gabbr1 B receptor 1 81657 0 1 0 8.285025 8.233409 8.018005 8.204665 8.468925 8.239622 AF000578_atcell division cycle 5-like (S. pombe)Cdc5l 85434 0 1 0 5.936608 6.337215 5.936394 6.311617 6.142254 6.29355 AF003835_atisopentenyl-diphosphate delta isomeraseIdi1 89784 0 1 0 7.979409 8.09663 8.173271 8.078657 8.261587 7.693236 AF004017_atsolute carrier family 4, member 4Slc4a4 84484 0 1 1 7.466527 7.494615 6.807704 7.158258 7.393016 7.262946 AF008554_atimplantation-associated protein ///Iag2 hypothetical /// LOC497846116967 gene ///supported 497846 by NM_0539460 0 1 5.951776 6.118631 5.912212 6.361877 6.566473 6.257753 AF016296_atneuropilin 1 Nrp1 246331 0 0 1 5.331779 5.511385 5.651146 5.82091 5.683705 5.848745 AF016503_s_atprocollagen C-proteinase enhancerPcolce protein 29569 0 1 1 6.334557 6.197958 6.644358 6.41737 6.456822 6.22386 AF019974_atchromogranin B Chgb 24259 0 0 1 8.765086 8.78747 8.934178 8.920665 8.629223 9.143192 AF021923_atsolute carrier family 24 (sodium/potassium/calciumSlc24a2 84550 exchanger), member 2 0 0 1 5.082939 4.773312 4.526509 4.87298 4.947145 5.231096 AF023087_s_atearly growth response 1 Egr1 24330 0 0 1 8.427394 8.404579 8.588229 8.874416 8.647098 8.447011 AF025308_f_atRT1 class Ib, locus Cl RT1-Cl 24977 1 0 0 8.00595 7.913228 7.810876 8.464425 8.050921 8.314959 AF028784cds#1_s_atglial fibrillary acidic protein Gfap 24387 1 1 1 8.684355 8.169441 8.372311 9.523585 9.699723 10.00132 AF028784mRNA#1_s_atglial fibrillary acidic protein Gfap 24387 1 1 1 11.12753 10.99265 11.29551 11.63683 11.86867 12.01254 AF030358_g_atchemokine (C-X3-C motif) ligandCx3cl1 1 89808 0 1 1 7.521507 7.229964 7.493598 7.225529 7.097255 7.697727 AF031878_atperipherin 1 Prph1 24688 0 0 1 7.431292 8.075672 7.170809 8.438139 9.007727 7.412089 AF031880_atneurofilament, light polypeptide RGD:621458 83613 0 1 1 11.26298 11.52124 11.36752 11.34829 11.60174 11.50365 AF034237_s_atSimilar to Pleckstrin homology domain-containing--- 361659 protein family A member 1 (T0andem PH domain1 containing0 protein-1) (TAPP-1) 7.929331 7.775906 8.021041 7.457763 7.546938 7.64997 AF034582_g_atSEC31-like 1 (S. cerevisiae) Sec31l1 93646 0 0 1 6.744512 6.241957 6.709281 6.259005 6.532958 7.169547 AF034863_atactivin receptor interacting proteinAcvrinp1 1 113970 0 1 1 6.47224 6.214972 6.167044 6.169529 6.201835 6.361347 AF034899_i_atolfactory receptor 1696 /// olfactoryOlr1696 receptor /// Olr1687 2941581687 /// //////olfactory Olr1697_predicted309574 receptor /// 406010 1697 /// Olr1699_predicted40601(predicted)0 1 /// 406012 /// 1olfactory ////// 406013Olr1700_predicted receptor0 1699 (predicted) /// Olr1701_predicted /// olfactory3.740373 receptor4.558165 1700 (predicted)3.814012 /// olfactory3.71697 receptor3.94621 17011 (predicted)3.53975 AF035632_s_atsyntaxin 12 Stx12 65033 1 0 0 6.071438 5.885272 5.858304 6.504073 6.489695 6.214658 AF036548_g_atresponse gene to complement 32Rgc32 117183 0 1 1 8.092911 7.886131 7.746268 7.481906 7.776486 7.401624 AF038571_s_atsolute carrier family 1 (neuronal/epithelialSlc1a1 high affinity25550 glutamate transporter, system0 Xag), 1member 1 0 6.43044 6.454274 6.303185 6.659439 6.542393 6.517438 AF044201_atFas apoptotic inhibitory moleculeFaim2 2 246274 0 0 1 9.137927 8.638364 8.817562 9.060626 8.747301 9.298435 AF052042_s_atzinc finger protein Y1 (RLZF-Y) ///RGD:628654 similar to hypothetical252860 /// LOC498000 /// 498000 protein D11Ertd99e 0 0 1 7.468636 7.039699 7.272321 7.463054 7.592297 7.636203 AF062594_g_atnucleosome assembly protein 1-likeNap1l1 1 89825 1 0 0 4.1105 4.106037 4.217608 4.555329 4.443644 4.680965 AF062741_g_atpyruvate dehydrogenase phosphatasePdp2 isoenzyme24631 2 1 0 1 1 4.769465 4.916709 4.897414 4.932317 5.052709 5.072137 AF063102_atlatrophilin 2 Lphn2 171447 0 0 1 7.084468 6.836335 6.916837 6.825259 6.577381 7.085944 AF063102_g_atlatrophilin 2 Lphn2 171447 0 0 1 7.624871 7.532497 7.716798 7.547647 7.321629 7.533912 AF065438_atlectin, galactoside-binding, soluble,Lgals3bp 3 binding protein245955 0 1 1 6.382444 6.771721 6.499971 6.797817 6.638921 6.799477 AF069782_atnucleolar protein 5 Nol5 60373 1 1 0 5.93788 5.866346 5.864967 6.132575 6.169147 6.574835 AF072865_atthioredoxin reductase 2 Txnrd2 50551 0 0 1 7.16539 7.283106 7.29469 7.139948 7.113709 7.019299 AF074609mRNA_f_atRT1 class Ib, locus Aw2 /// RT1 classRT1-A I,w2 CE2 /// 24737R///T1-CE2 RT1 /// class 414779 /// RGD:1359630 I, CE15 /// 414789 1 0 0 6.772062 6.785721 7.074547 7.196644 6.884024 7.300243 AF076619_atgrowth factor receptor bound proteinGrb14 14 58844 1 0 0 5.813703 5.889575 6.196898 6.074653 6.669329 6.457343 AF083269_atactin related protein 2/3 complex,Arpc1b subunit 1B 54227 1 1 1 6.986856 7.065453 7.492095 8.308753 8.326325 8.09574 AF083269_g_atactin related protein 2/3 complex,Arpc1b subunit 1B 54227 1 1 1 6.296737 6.442983 6.885259 7.88689 7.872126 7.66563 AF085693_atG protein-coupled receptor kinaseGit1 interactor 1 83709 0 0 1 6.896488 6.697951 6.744651 6.84635 6.800857 7.347479 AF085693_g_atG protein-coupled receptor kinaseGit1 interactor 1 83709 0 0 1 7.155267 7.007447 7.240589 7.256222 7.074014 7.650189 AF087437UTR#1_s_atcore binding factor beta Cbfb 361391 0 0 1 8.128212 7.807239 8.51197 8.337042 8.651237 8.590589 AF089839_atN-ethylmaleimide sensitive fusionNsf protein 60355 1 0 0 6.940214 6.532927 6.069304 7.124849 7.21367 7.490845 AF091834_atN-ethylmaleimide sensitive fusionNsf protein 60355 1 1 0 7.825188 7.335741 6.922582 7.982196 8.15595 8.124499 AF093139_s_atnuclear RNA export factor 1 /// hypotheticalRGD:62014 gene 497739/// LOC497739 supported /// 59087 by NM_021579 0 0 1 7.344724 7.396475 7.608996 7.63952 7.606433 8.013095 AF093268_s_athomer homolog 1 (Drosophila) Homer1 29546 0 1 1 4.318483 4.401746 4.208581 4.185099 4.271572 4.407992 AF100421_atmetadherin Mtdh 170910 0 1 1 6.573115 6.625708 6.714494 6.432372 6.904946 7.065458 AJ002556_s_atmicrotubule-associated protein 6Mtap6 29457 0 1 0 5.974567 6.004931 6.049466 6.460262 6.317957 6.742993 AJ003065_atpotassium inwardly-rectifying channel,Kcnj14 subfamily276720 J, member 14 0 0 1 5.04343 5.272913 5.200986 5.330935 5.494317 5.276686 AJ006855_s_atsynaptojanin 1 Synj1 85238 0 0 1 8.036186 8.040258 7.849836 8.010273 7.890248 8.398375 AJ006971_g_atdeath-associated protein kinase Dapk33 64391 0 1 0 7.333773 7.295251 7.396676 7.655184 7.738843 7.81915 AJ007016_atprotein tyrosine phosphatase 4a2Ptp4a2 85237 0 0 1 7.990608 7.837598 8.012237 7.827588 7.89215 8.138306 AJ010386_s_atCUG triplet repeat,RNA-binding Cugbp2protein 2 29428 0 0 1 5.830503 5.975626 5.984955 5.857313 5.914933 6.05641 AJ131902_g_atgrowth arrest specific 7 Gas7 85246 0 0 1 6.472318 5.729711 6.948858 6.398373 5.497602 6.685409 AJ222813_s_atinterleukin 18 Il18 29197 1 0 1 4.811845 4.88036 5.001605 5.144022 5.046093 5.641278 AJ223355_atsolute carrier family 25 (mitochondrialRGD:621430 carrier; dicarboxylate170943 transporter), member0 10 1 1 6.170611 5.993883 6.23051 6.252818 5.933927 6.623242 C06598_at similar to binding protein LOC293702 293702 0 0 1 9.663116 9.706298 9.493465 9.732518 9.787873 9.748714 D00189_at ATPase, Na+/K+ transporting, alphaAtp1a3 3 polypeptide24213 0 1 1 9.684519 9.48154 9.54232 9.720475 9.554769 10.22657 D00636cds_s_atdiaphorase 1 Dia1 25035 0 0 1 7.064656 6.810901 6.787797 7.159203 7.217961 7.026151 D00680_at glutathione peroxidase 3 Gpx3 64317 0 0 1 5.468218 5.603596 5.446046 5.453763 5.397417 5.930457 D00688_s_atmonoamine oxidase A Maoa 29253 0 0 1 7.352218 7.195075 7.295817 7.079696 7.52042 7.406681 D01046_at RAB11B, member RAS oncogeneRab1 family1b 79434 0 1 1 8.021498 7.648 7.887615 8.069982 7.627385 8.214144 D10770_s_atprotein kinase, cAMP dependent,Prkacb_predicted catalytic, beta293508 (predicted) 1 1 0 6.52715 6.381715 5.899562
Recommended publications
  • The Switch from Fermentation to Respiration in Saccharomyces Cerevisiae Is Regulated by the Ert1 Transcriptional Activator/Repressor

    The Switch from Fermentation to Respiration in Saccharomyces Cerevisiae Is Regulated by the Ert1 Transcriptional Activator/Repressor

    INVESTIGATION The Switch from Fermentation to Respiration in Saccharomyces cerevisiae Is Regulated by the Ert1 Transcriptional Activator/Repressor Najla Gasmi,* Pierre-Etienne Jacques,† Natalia Klimova,† Xiao Guo,§ Alessandra Ricciardi,§ François Robert,†,** and Bernard Turcotte*,‡,§,1 ‡Department of Medicine, *Department of Biochemistry, and §Department of Microbiology and Immunology, McGill University Health Centre, McGill University, Montreal, QC, Canada H3A 1A1, †Institut de recherches cliniques de Montréal, Montréal, QC, Canada H2W 1R7, and **Département de Médecine, Faculté de Médecine, Université de Montréal, QC, Canada H3C 3J7 ABSTRACT In the yeast Saccharomyces cerevisiae, fermentation is the major pathway for energy production, even under aerobic conditions. However, when glucose becomes scarce, ethanol produced during fermentation is used as a carbon source, requiring a shift to respiration. This adaptation results in massive reprogramming of gene expression. Increased expression of genes for gluconeogenesis and the glyoxylate cycle is observed upon a shift to ethanol and, conversely, expression of some fermentation genes is reduced. The zinc cluster proteins Cat8, Sip4, and Rds2, as well as Adr1, have been shown to mediate this reprogramming of gene expression. In this study, we have characterized the gene YBR239C encoding a putative zinc cluster protein and it was named ERT1 (ethanol regulated transcription factor 1). ChIP-chip analysis showed that Ert1 binds to a limited number of targets in the presence of glucose. The strongest enrichment was observed at the promoter of PCK1 encoding an important gluconeogenic enzyme. With ethanol as the carbon source, enrichment was observed with many additional genes involved in gluconeogenesis and mitochondrial function. Use of lacZ reporters and quantitative RT-PCR analyses demonstrated that Ert1 regulates expression of its target genes in a manner that is highly redundant with other regulators of gluconeogenesis.
  • Supplementary Table S4. FGA Co-Expressed Gene List in LUAD

    Supplementary Table S4. FGA Co-Expressed Gene List in LUAD

    Supplementary Table S4. FGA co-expressed gene list in LUAD tumors Symbol R Locus Description FGG 0.919 4q28 fibrinogen gamma chain FGL1 0.635 8p22 fibrinogen-like 1 SLC7A2 0.536 8p22 solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 DUSP4 0.521 8p12-p11 dual specificity phosphatase 4 HAL 0.51 12q22-q24.1histidine ammonia-lyase PDE4D 0.499 5q12 phosphodiesterase 4D, cAMP-specific FURIN 0.497 15q26.1 furin (paired basic amino acid cleaving enzyme) CPS1 0.49 2q35 carbamoyl-phosphate synthase 1, mitochondrial TESC 0.478 12q24.22 tescalcin INHA 0.465 2q35 inhibin, alpha S100P 0.461 4p16 S100 calcium binding protein P VPS37A 0.447 8p22 vacuolar protein sorting 37 homolog A (S. cerevisiae) SLC16A14 0.447 2q36.3 solute carrier family 16, member 14 PPARGC1A 0.443 4p15.1 peroxisome proliferator-activated receptor gamma, coactivator 1 alpha SIK1 0.435 21q22.3 salt-inducible kinase 1 IRS2 0.434 13q34 insulin receptor substrate 2 RND1 0.433 12q12 Rho family GTPase 1 HGD 0.433 3q13.33 homogentisate 1,2-dioxygenase PTP4A1 0.432 6q12 protein tyrosine phosphatase type IVA, member 1 C8orf4 0.428 8p11.2 chromosome 8 open reading frame 4 DDC 0.427 7p12.2 dopa decarboxylase (aromatic L-amino acid decarboxylase) TACC2 0.427 10q26 transforming, acidic coiled-coil containing protein 2 MUC13 0.422 3q21.2 mucin 13, cell surface associated C5 0.412 9q33-q34 complement component 5 NR4A2 0.412 2q22-q23 nuclear receptor subfamily 4, group A, member 2 EYS 0.411 6q12 eyes shut homolog (Drosophila) GPX2 0.406 14q24.1 glutathione peroxidase
  • New Targets of Urocortin-Mediated Cardioprotection

    New Targets of Urocortin-Mediated Cardioprotection

    69 New targets of urocortin-mediated cardioprotection Sea´n P Barry1, Kevin M Lawrence4, James McCormick1, Surinder M Soond5, Mike Hubank2, Simon Eaton3, Ahila Sivarajah6, Tiziano M Scarabelli7, Richard A Knight1, Christoph Thiemermann6, David S Latchman1, Paul A Townsend8 and Anastasis Stephanou1 1Medical Molecular Biology Unit, 2Department of Molecular Haematology and 3Department of Surgery, Institute of Child Health, University College London, 30 Guilford Street, London, WC1N 1EH, UK 4Department of Cellular Pathology, St George’s, University of London, Cranmer Terrace, Tooting, London, SW17 0RE, UK 5School of Biological Sciences, University of East Anglia, Norwich, NR4 7TJ, UK 6St Bartholomew’s and The Royal London School of Medicine and Dentistry, William Harvey Research Institute, Centre for Translational Medicine and Therapeutics, Queen Mary University of London, London, EC1M 7BQ, UK 7Center for Heart and Vessel Preclinical Studies, St John Hospital and Medical Center, Wayne State University School of Medicine, 22201 Moross Road, Detroit, Michigan 48336, USA 8Human Genetics Division, MP808, Southampton General Hospital, University of Southampton, Southampton SO16 6YD, UK (Correspondence should be addressed to S P Barry; Email: [email protected]) Abstract The urocortin (UCN) hormones UCN1 and UCN2 have been shown previously to confer significant protection against myocardial ischaemia/reperfusion (I/R) injury; however, the molecular mechanisms underlying their action are poorly understood. To further define the transcriptional effect of UCNs that underpins their cardioprotective activity, a microarray analysis was carried out using an in vivo rat coronary occlusion model of I/R injury. Infusion of UCN1 or UCN2 before the onset of reperfusion resulted in the differential regulation of 66 and 141 genes respectively, the majority of which have not been described previously.
  • Maren Mommens Phd Thesis

    Maren Mommens Phd Thesis

    MATERNAL EFFECTS ON OOCYTE QUALITY IN FARMED ATLANTIC HALIBUT (HIPPOGLOSSUS HIPPOGLOSSUS L.) Maren Mommens A Thesis Submitted for the Degree of PhD at the University of St Andrews 2012 Full metadata for this item is available in Research@StAndrews:FullText at: http://research-repository.st-andrews.ac.uk/ Please use this identifier to cite or link to this item: http://hdl.handle.net/10023/3661 This item is protected by original copyright Maternal effects on oocyte quality in farmed Atlantic halibut (Hippoglossus hippoglossus L.) Maren Mommens This thesis is submitted in partial fulfilment for the degree of PhD at the University of St Andrews September 2011 This thesis is dedicated to my parents. 2 Acknowledgements First of all, I would like to express my gratitude to my supervisors Professor Ian A. Johnston, Professor Igor Babiak and Dr. Jorge M.O. Fernandes for their invaluable support, advice and constructive feedback. My thanks go to Risør Fisk AS and especially Kjell E. Naas and Yngve Attramadal for their cooperation and help during sampling. The microarray collaboration with Dr. Knut Erik Tollefsen from the Norwegian Institute for Water Research (NIVA) was much appreciated and I would like to thank You Song for his excellent training in microarray preparation. The members of the Fish Muscle Research Group at the University of St. Andrews introduced me to molecular biology and I would especially like to thank Dr. Hung-Tai Lee and Dr. Sitheswarab Nainamalai for help and support in the lab. Dr. Neil Bower arrived at the same time as me in St.Andrews and together with his family we shared our Scotland experience.
  • Strand Breaks for P53 Exon 6 and 8 Among Different Time Course of Folate Depletion Or Repletion in the Rectosigmoid Mucosa

    Strand Breaks for P53 Exon 6 and 8 Among Different Time Course of Folate Depletion Or Repletion in the Rectosigmoid Mucosa

    SUPPLEMENTAL FIGURE COLON p53 EXONIC STRAND BREAKS DURING FOLATE DEPLETION-REPLETION INTERVENTION Supplemental Figure Legend Strand breaks for p53 exon 6 and 8 among different time course of folate depletion or repletion in the rectosigmoid mucosa. The input of DNA was controlled by GAPDH. The data is shown as ΔCt after normalized to GAPDH. The higher ΔCt the more strand breaks. The P value is shown in the figure. SUPPLEMENT S1 Genes that were significantly UPREGULATED after folate intervention (by unadjusted paired t-test), list is sorted by P value Gene Symbol Nucleotide P VALUE Description OLFM4 NM_006418 0.0000 Homo sapiens differentially expressed in hematopoietic lineages (GW112) mRNA. FMR1NB NM_152578 0.0000 Homo sapiens hypothetical protein FLJ25736 (FLJ25736) mRNA. IFI6 NM_002038 0.0001 Homo sapiens interferon alpha-inducible protein (clone IFI-6-16) (G1P3) transcript variant 1 mRNA. Homo sapiens UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 15 GALNTL5 NM_145292 0.0001 (GALNT15) mRNA. STIM2 NM_020860 0.0001 Homo sapiens stromal interaction molecule 2 (STIM2) mRNA. ZNF645 NM_152577 0.0002 Homo sapiens hypothetical protein FLJ25735 (FLJ25735) mRNA. ATP12A NM_001676 0.0002 Homo sapiens ATPase H+/K+ transporting nongastric alpha polypeptide (ATP12A) mRNA. U1SNRNPBP NM_007020 0.0003 Homo sapiens U1-snRNP binding protein homolog (U1SNRNPBP) transcript variant 1 mRNA. RNF125 NM_017831 0.0004 Homo sapiens ring finger protein 125 (RNF125) mRNA. FMNL1 NM_005892 0.0004 Homo sapiens formin-like (FMNL) mRNA. ISG15 NM_005101 0.0005 Homo sapiens interferon alpha-inducible protein (clone IFI-15K) (G1P2) mRNA. SLC6A14 NM_007231 0.0005 Homo sapiens solute carrier family 6 (neurotransmitter transporter) member 14 (SLC6A14) mRNA.
  • Sequencing, Analysis, and Annotation of Expressed Sequence Tags for Camelus Dromedarius

    Sequencing, Analysis, and Annotation of Expressed Sequence Tags for Camelus Dromedarius

    University of Nebraska - Lincoln DigitalCommons@University of Nebraska - Lincoln Faculty Publications from the Department of Electrical & Computer Engineering, Department Electrical and Computer Engineering of 2009 Sequencing, Analysis, and Annotation of Expressed Sequence Tags for Camelus dromedarius Abdulaziz M. Al-Swailem King Abdulaziz City for Science and Technology Maher M. Shehata King Abdulaziz City for Science and Technology Faisel M. Abu-Duhier King Abdulaziz City for Science and Technology Essam J. Al-Yamani King Abdulaziz City for Science and Technology Khalid A. Al-Busadah King Faisal University See next page for additional authors Follow this and additional works at: https://digitalcommons.unl.edu/electricalengineeringfacpub Part of the Computer Engineering Commons, and the Electrical and Computer Engineering Commons Al-Swailem, Abdulaziz M.; Shehata, Maher M.; Abu-Duhier, Faisel M.; Al-Yamani, Essam J.; Al-Busadah, Khalid A.; Al-Arawi, Mohammed S.; Al-Khider, Ali Y.; Al-Muhaimeed, Abdullah N.; Al-Qahtani, Fahad H.; Manee, Manee M.; Al-Shomrani, Badr M.; Al-Qhtani, Saad M.; Al-Harthi, Amer S.; Akdemir, Kadir C.; Inan, Mehmet S.; and Otu, Hasan H., "Sequencing, Analysis, and Annotation of Expressed Sequence Tags for Camelus dromedarius" (2009). Faculty Publications from the Department of Electrical and Computer Engineering. 426. https://digitalcommons.unl.edu/electricalengineeringfacpub/426 This Article is brought to you for free and open access by the Electrical & Computer Engineering, Department of at DigitalCommons@University of Nebraska - Lincoln. It has been accepted for inclusion in Faculty Publications from the Department of Electrical and Computer Engineering by an authorized administrator of DigitalCommons@University of Nebraska - Lincoln. Authors Abdulaziz M. Al-Swailem, Maher M.
  • PRODUCT SPECIFICATION Anti-ZNF180 Product Datasheet

    PRODUCT SPECIFICATION Anti-ZNF180 Product Datasheet

    Anti-ZNF180 Product Datasheet Polyclonal Antibody PRODUCT SPECIFICATION Product Name Anti-ZNF180 Product Number HPA028980 Gene Description zinc finger protein 180 Clonality Polyclonal Isotype IgG Host Rabbit Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: QEILLQEVAFTQRKAVIHERVCKSDETGEKSGLNSSLFSSPVIPIRNHFH KHVSHAKKWHLNAAVNSHQKINENETLYENNECGKPPQSIHLIQFTRTQT KDKCYGFSDRIQSFCHGTPLHIHEKIHGGGKTFDFKECGQ Purification Method Affinity purified using the PrEST antigen as affinity ligand Verified Species Human Reactivity Recommended IHC (Immunohistochemistry) Applications - Antibody dilution: 1:200 - 1:500 - Retrieval method: HIER pH6 ICC-IF (Immunofluorescence) - Fixation/Permeabilization: PFA/Triton X-100 - Working concentration: 0.25-2 µg/ml Characterization Data Available at atlasantibodies.com/products/HPA028980 Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Concentration Lot dependent Storage Store at +4°C for short term storage. Long time storage is recommended at -20°C. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. For protocols, additional product information, such as images and references, see atlasantibodies.com. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions. Atlas Antibodies AB's sole liability is limited to replacement of the product or refund of the purchase price.
  • Supplementary Data

    Supplementary Data

    Supplemental Material Materials and Methods Immunohistochemistry Primary antibodies used for validation studies include: mouse anti-desmoglein-3 (Cat. # 32-6300, Invitrogen, CA, USA; 1:25), rabbit anti-cytokeratin 4 (Cat. # ab11215, Abcam, Cambridge, MA, USA; 1:100), mouse anti-cytokeratin 16 (Cat. # ab8741, Abcam; 1:25), rabbit anti-desmoplakin antibody (Cat. # ab14418, Abcam; 1:200), mouse anti-vimentin (Cat. # M7020, Dako, Carpinteria, CA, USA; 1:100). Secondary antibodies conjugated with biotin (Vector, Burlingame, CA, USA) were used, diluted to 1:400. Tissues slides containing archival FFPE sections, or tissue micro arrays (TMA) consisting of 508 HNSCC and controls, were dewaxed in SafeClear II (Fisher Scientific, Pittsburgh, PA, USA) hydrated through graded alcohols, immersed in 3% hydrogen peroxide in PBS for 30 min to quench the endogenous peroxidase, and processed for antigen retrieval and immunostaining with the appropriate primary antibodies and biotinylated secondary antibodies as described (1), followed by the avidin-biotin complex method (Vector Stain Elite, ABC kit; Vector). Slides were washed and developed in 3,3'- diaminobenzidine (Sigma FASTDAB tablet; Sigma Chemical) under microscopic control, and counterstained with Mayer's hematoxylin. For each stained TMA the number of positive cells in each core was visually evaluated and the results expressed as a percentage of stained cells/ total number of cells. According to their immunoreactivity the tissues array cores were divided according to tumor differentiation, where the percentage of stained cells in the three tumor classes were scored as more than 5% and less than 25% of the cells stained, 26 to 50%, 51 to 75% or, 75 to 100%.
  • Targeted Proteomic Approach in Prostatic Tissue: a Panel of Potential Biomarkers for Cancer Detection

    Targeted Proteomic Approach in Prostatic Tissue: a Panel of Potential Biomarkers for Cancer Detection

    www.impactjournals.com/oncoscience Oncoscience, Vol. 3 (7-8), July 2016 Targeted proteomic approach in prostatic tissue: a panel of potential biomarkers for cancer detection Donatella Aiello1,*, Francesca Casadonte2,*, Rosa Terracciano2, Rocco Damiano2, Rocco Savino2, Giovanni Sindona1, Anna Napoli1 1 Department of Chemistry and Chemical Technologies, University of Calabria, Italy 2 Department of Health Sciences, Magna Græcia University of Catanzaro, Catanzaro, Italy * These authors have contributed equally to this work Correspondence to: Anna Napoli, email: [email protected] Keywords: PCa tissue, biomarker, metabolic pathway, bodily fluids, proteome Received: May 29, 2016 Accepted: June 03, 2016 Published: July 08, 2016 This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. ABSTRACT Prostate cancer (PCa) is the sixth highest causes of cancer-related deaths in men. The molecular events underlying its behavior and evolution are not completely understood. Prostate-specific antigen (PSA) is the only approved Food and Drug Administration biomarker. A panel of ten stage-specific tumoral and adjacent non tumoral tissues from patients affected by PCa (Gleason score 6, 3+3; PSA 10 ÷19 ng/ml) was investigated by MS-based proteomics approach. The proposed method was based on identifying the base-soluble proteins from tissue, established an efficient study, which lead to a deeper molecular perspective understanding of the PCa. A total of 164 proteins were found and 132 of these were evaluated differentially expressed in tumoral tissues. The Ingenuity Pathway Analysis (IPA) showed that among all dataset obtained, 105 molecules were involved in epithelial neoplasia with a p-value of 3.62E-05, whereas, only 11 molecules detected were ascribed to sentinel tissue and bodily fluids.
  • Assay for Quantitative Evaluation of Target Site Cleavage by One Or More Crispr-Cas Guide Sequences

    Assay for Quantitative Evaluation of Target Site Cleavage by One Or More Crispr-Cas Guide Sequences

    (19) *EP003011035B1* (11) EP 3 011 035 B1 (12) EUROPEAN PATENT SPECIFICATION (45) Date of publication and mention (51) Int Cl.: of the grant of the patent: C12N 15/63 (2006.01) C12N 15/10 (2006.01) (2006.01) (2006.01) 13.05.2020 Bulletin 2020/20 C40B 40/08 C12N 9/22 (21) Application number: 14738672.6 (86) International application number: PCT/US2014/041790 (22) Date of filing: 10.06.2014 (87) International publication number: WO 2014/204723 (24.12.2014 Gazette 2014/52) (54) ASSAY FOR QUANTITATIVE EVALUATION OF TARGET SITE CLEAVAGE BY ONE OR MORE CRISPR-CAS GUIDE SEQUENCES TEST ZUR QUANTITATIVEN BEWERTUNG DER ZIELSTELLENSPALTUNG DURCH EINE ODER MEHRERE CRISPR-CAS FÜHRUNGSSEQUENZEN TEST POUR L’ÉVALUATION QUANTITATIVE DU CLIVAGE DE SITES CIBLES PAR UNE OU PLUSIEURS SÉQUENCES GUIDES DU SYSTÈME CRISPR-CAS (84) Designated Contracting States: (56) References cited: AL AT BE BG CH CY CZ DE DK EE ES FI FR GB • GAJ THOMAS ET AL: "ZFN, TALEN, and GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO CRISPR/Cas-based methods for genome PL PT RO RS SE SI SK SM TR engineering", TRENDS IN BIOTECHNOLOGY, ELSEVIER PUBLICATIONS, CAMBRIDGE, GB, (30) Priority: 17.06.2013 US 201361836123 P vol. 31, no. 7, 9 May 2013 (2013-05-09), pages 12.12.2013 US 201361915397 P 397-405, XP028571313, ISSN: 0167-7799, DOI: 10.1016/J.TIBTECH.2013.04.004 (43) Date of publication of application: • JANSSEN K P ET AL: "Mouse models of 27.04.2016 Bulletin 2016/17 K-ras-initiated carcinogenesis", BBA - REVIEWS ON CANCER, ELSEVIER SCIENCE BV, (73) Proprietors: AMSTERDAM, NL, vol.
  • Protein H00007733-P01-10Ug

    Protein H00007733-P01-10Ug

    Product Datasheet Recombinant Human Zinc finger protein 180 GST (N-Term) Protein H00007733-P01-10ug Unit Size: 10 ug Store at -80C. Avoid freeze-thaw cycles. Protocols, Publications, Related Products, Reviews, Research Tools and Images at: www.novusbio.com/H00007733-P01 Updated 11/4/2020 v.20.1 Earn rewards for product reviews and publications. Submit a publication at www.novusbio.com/publications Submit a review at www.novusbio.com/reviews/destination/H00007733-P01 Page 1 of 3 v.20.1 Updated 11/4/2020 H00007733-P01-10ug Recombinant Human Zinc finger protein 180 GST (N-Term) Protein Product Information Unit Size 10 ug Concentration Please see the vial label for concentration. If unlisted please contact technical services. Storage Store at -80C. Avoid freeze-thaw cycles. Preservative No Preservative Purity >80% by SDS-PAGE and Coomassie blue staining Buffer 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. Target Molecular Weight 105.7 kDa Product Description Description A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-691 of Human ZNF180 full-length ORF Source: Wheat Germ (in vitro) Amino Acid Sequence: MRRVYAGSWKRCAAQDLSTLLCLEESMEEQDEKPPEPPKACAQDSFLPQEIII KVEGEDTGSLTIPSQEGVNFKIVTVDFTREEQGTWNPAQRTLDRDVILENHRDL VSWDLATAVGKKDSTSKQRIFDEEPANGVKIERFTRDDPWLSSCEEVDDCKDQ LEKQQEKQEILLQEVAFTQRKAVIHERVCKSDETGEKSGLNSSLFSSPVIPIRNH FHKHVSHAKKWHLNAAVNSHQKINENETLYENNECGKPPQSIHLIQFTRTQTKD KCYGFSDRIQSFCHGTPLHIHEKIHGGGKTFDFKECGQVLNPKISHNEQQRIPF EESQYKCSETSHSSSLTQNMRNNSEEKPFECNQCGKSFSWSSHLVAHQRTHT
  • Role of Lactic Acid Bacteria During Meat Conditioning and Fermentation: Peptides Generated As Sensorial and Hygienic Biomarkers

    Role of Lactic Acid Bacteria During Meat Conditioning and Fermentation: Peptides Generated As Sensorial and Hygienic Biomarkers

    Meat Science 86 (2010) 66–79 Contents lists available at ScienceDirect Meat Science journal homepage: www.elsevier.com/locate/meatsci Review Role of lactic acid bacteria during meat conditioning and fermentation: Peptides generated as sensorial and hygienic biomarkers Silvina Fadda ⁎, Constanza López, Graciela Vignolo Centro de Referencia para Lactobacilos (CERELA-CONICET), Tucumán, Argentina article info abstract Article history: The microbial ecology of meat fermentation is a complex process in which lactic acid bacteria (LAB) and Received 9 February 2010 coagulase-negative cocci play a major role. The present work reviews the most significant developments in Received in revised form 31 March 2010 which LAB are the main characters acting both as starter cultures improving the sensorial quality and as Accepted 6 April 2010 biopreservative agents. New findings about the identification of low molecular weight peptides arisen from protein hydrolysis in dry fermented sausages and their relation with flavor is presented. Also, a brief Keywords: description of a proteomic approach is detailed in order to exemplify its application as a tool in the search for Lactic acid bacteria Meat products improved LAB strains that will contribute to food quality and safety. Finally, the most important features of Starter cultures bacteriocinogenic LAB and its bacteriocins in bioprotection of meat and meat products are analyzed. Flavor peptides © 2010 The American Meat Science Association. Published by Elsevier Ltd. All rights reserved. Biopreservation Proteomics Contents 1. Introduction ...............................................................66 2. Role of LAB in meat protein degradation. An overview ...........................................67 2.1. Proteolytic compounds generated during sausage fermentation ...................................68 2.1.1. Analysis of Argentinean fermented sausages according to their proteolytic profiles......................68 2.1.2.