OPTC Polyclonal Antibody Gene Alias: OPT

Total Page：16

File Type：pdf, Size：1020Kb

OPTC polyclonal antibody Gene Alias: OPT Catalog Number: PAB22838 Gene Summary: Opticin belongs to class III of the small leucine-rich repeat protein (SLRP) family. Members of Regulatory Status: For research use only (RUO) this family are typically associated with the extracellular matrix. Opticin is present in significant quantities in the Product Description: Rabbit polyclonal antibody raised vitreous of the eye and also localizes to the cornea, iris, against recombinant OPTC. ciliary body, optic nerve, choroid, retina, and fetal liver. Opticin may noncovalently bind collagen fibrils and Immunogen: Recombinant protein corresponding to regulate fibril morphology, spacing, and organization. amino acids of human OPTC. The opticin gene is mapped to a region of chromosome 1 that is associated with the inherited eye diseases Sequence: age-related macular degeneration (AMD) and posterior RIDLSNNLISSIDNDAFRLLHALQDLILPENQLEALPVLP column ataxia with retinosa pigmentosa (AXPC1). SGIEFLDVRLNRLQSSGIQPAAFRAMEKLQFLYLSDNL [provided by RefSeq] LDSIP Host: Rabbit Reactivity: Human Applications: IHC-P (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Form: Liquid Purification: Antigen affinity purification Isotype: IgG Recommend Usage: Immunohistochemistry (1:20-1:50) The optimal working dilution should be determined by the end user. Storage Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) Storage Instruction: Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 26254 Gene Symbol: OPTC Page 1/1 Powered by TCPDF (www.tcpdf.org).

Copy Link

Recommended publications

Plasma Kallikrein-Kinin System As a VEGF-Independent Mediator of Diabetic
Page 1 of 52 Diabetes Plasma Kallikrein-Kinin System as a VEGF-Independent Mediator of Diabetic Macular Edema Takeshi Kita1, Allen C. Clermont1, Nivetha Murugesan1 Qunfang Zhou1, Kimihiko 2 2 1,3 1,4 Fujisawa , Tatsuro Ishibashi , Lloyd Paul Aiello , Edward P. Feener 1 Joslin Diabetes Center, Harvard Medical School, One Joslin Place, Boston, MA 02215, USA 2 Department of Ophthalmology, Graduate School of Medical Sciences, Kyushu University, 3-1-1 Maidashi, Higashi-Ku, Fukuoka 812-8582, Japan. 3 Beetham Eye Institute, Department of Ophthalmology, Harvard Medical School, One Joslin Place, Boston, MA 02215, USA 4 Department of Medicine, Harvard Medical School, One Joslin Place, Boston, MA 02215, USA Corresponding Author: Edward P. Feener, Ph.D., Joslin Diabetes Center, Harvard Medical School, One Joslin Place, Boston, MA 02215, USA. Phone: 617-307-2599, Fax:617-307-2637. e-mail: [email protected] 1 Diabetes Publish Ahead of Print, published online May 15, 2015 Diabetes Page 2 of 52 Abstract: This study characterizes the kallikrein kinin system in vitreous from individuals with diabetic macular edema (DME) and examines mechanisms contributing to retinal thickening and retinal vascular permeability (RVP). Plasma prekallikrein (PPK) and plasma kallikrein (PKal) were increased 2 and 11.0-fold (both p<0.0001), respectively, in vitreous from subjects with DME compared to those with macular hole (MH). While vascular endothelial growth factor (VEGF) was also increased in DME vitreous, PKal and VEGF concentrations do not correlate (r=0.266, p=0.112). Using mass spectrometry-based proteomics we identified 167 vitreous proteins, including 30 that were increased in DME (> 4-fold, p< 0.001 vs.
[Show full text]
An Evaluation of OPTC and EPYC As Candidate Genes for High Myopia
Molecular Vision 2009; 15:2045-2049 <http://www.molvis.org/molvis/v15/a219> © 2009 Molecular Vision Received 19 July 2009 | Accepted 12 October 2009 | Published 15 October 2009 An evaluation of OPTC and EPYC as candidate genes for high myopia Panfeng Wang, Shiqiang Li, Xueshan Xiao, Xiangming Guo, Qingjiong Zhang State Key Laboratory of Ophthalmology, Zhongshan Ophthalmic Center, Sun Yat-sen University, Guangzhou, P. R. China Purpose: The small leucine-rich repeat proteins (SLRPs) are involved in organizing the collagen fibrils of the sclera and vitreous. The shape of the eyeball is determined by the sclera and vitreous, so defects in SLRP family members may contribute to myopia. The purpose of this study was to test whether mutations in the two members of the class III SLRPs, opticin (OPTC) and dermatan sulfate proteoglycan 3 (EPYC), are responsible for high myopia. Methods: DNA was prepared from venous leukocytes of 93 patients with high myopia (refraction of spherical equivalent ≤-6.00D) and 96 controls (refraction of spherical equivalent between -0.50D and +1.00D). The coding regions and adjacent intronic sequences of OPTC and EPYC were amplified by the polymerase chain reaction (PCR), and the products were then analyzed by cycle sequencing. The detected variations were further evaluated in normal controls and available family members by a heteroduplex-single strand conformation polymorphism (heteroduplex-SSCP) analysis or sequencing. Results: Two substitutions in OPTC, including c.491G>T and c.803T>C, were identified. The c.491G>T mutation (p.Arg164Leu), a novel heterozygous variation, was detected in one of the 93 patients but in none of the 96 controls.
[Show full text]
(12) United States Patent (10) Patent No.: US 7.873,482 B2 Stefanon Et Al
US007873482B2 (12) United States Patent (10) Patent No.: US 7.873,482 B2 Stefanon et al. (45) Date of Patent: Jan. 18, 2011 (54) DIAGNOSTIC SYSTEM FOR SELECTING 6,358,546 B1 3/2002 Bebiak et al. NUTRITION AND PHARMACOLOGICAL 6,493,641 B1 12/2002 Singh et al. PRODUCTS FOR ANIMALS 6,537,213 B2 3/2003 Dodds (76) Inventors: Bruno Stefanon, via Zilli, 51/A/3, Martignacco (IT) 33035: W. Jean Dodds, 938 Stanford St., Santa Monica, (Continued) CA (US) 90403 FOREIGN PATENT DOCUMENTS (*) Notice: Subject to any disclaimer, the term of this patent is extended or adjusted under 35 WO WO99-67642 A2 12/1999 U.S.C. 154(b) by 158 days. (21)21) Appl. NoNo.: 12/316,8249 (Continued) (65) Prior Publication Data Swanson, et al., “Nutritional Genomics: Implication for Companion Animals'. The American Society for Nutritional Sciences, (2003).J. US 2010/O15301.6 A1 Jun. 17, 2010 Nutr. 133:3033-3040 (18 pages). (51) Int. Cl. (Continued) G06F 9/00 (2006.01) (52) U.S. Cl. ........................................................ 702/19 Primary Examiner—Edward Raymond (58) Field of Classification Search ................... 702/19 (74) Attorney, Agent, or Firm Greenberg Traurig, LLP 702/23, 182–185 See application file for complete search history. (57) ABSTRACT (56) References Cited An analysis of the profile of a non-human animal comprises: U.S. PATENT DOCUMENTS a) providing a genotypic database to the species of the non 3,995,019 A 1 1/1976 Jerome human animal Subject or a selected group of the species; b) 5,691,157 A 1 1/1997 Gong et al.
[Show full text]
From Biochemistry to Clinical Relevance Search J
Chapter 16 Vitreous: From Biochemistry to Clinical Relevance Search J. SEBAG and KENNETH M. P. YEE Main Menu Table Of Contents VITREOUS BIOCHEMISTRY VITREOUS ANATOMY AGE-RELATED VITREOUS DEGENERATION VITREOUS PATHOLOGY PHARMACOLOGIC VITREOLYSIS REFERENCES Although vitreous is the largest structure within the eye, comprising 80% of its volume, our knowledge of vitreous structure and function is perhaps the least of all ocular tissues. Historically, investigations of vitreous structure have been hampered by two fundamental difficulties: first, any attempts to define vitreous morphology are attempts to visualize a tissue that is invisible by design (Fig. 1).1 Considerable barriers must be overcome to adequately study the structure of an invisible tissue. Second, the various techniques that were used previously to define vitreous structure were fraught with artifacts that biased the results of these investigations. Thus, as noted by Baurmann2 and Redslob,3 histologic studies performed during the nineteenth and early twentieth centuries were flawed by the use of tissue fixatives that caused the precipitation of what we recognize today as the glycosaminoglycan (GAG) hyaluronan (HA; formerly called hyaluronic acid). Fig. 1. Vitreous from a 9-month-old child. The sclera, choroid, and retina were dissected off the vitreous, which remains attached to the anterior segment. Because of the young age of the donor, the vitreous is almost entirely gel. Thus, the structure is solid and maintains its shape, although situated on a surgical towel exposed to room air. A band of gray tissue can be seen posterior to the ora serrata. This is peripheral retina that was firmly adherent to the vitreous base and could not be dissected away without disrupting the vitreous base.
[Show full text]
Cataract Surgery on the Other Hand, Successful Imple- Br J Ophthalmol: First Published As 10.1136/Bjo.2003.034918 on 16 April 2004
EDITORIAL 601 Cataract surgery On the other hand, successful imple- Br J Ophthalmol: first published as 10.1136/bjo.2003.034918 on 16 April 2004. Downloaded from ....................................................................................... mentation of high quality, high volume units within the NHS can be achieved and be a positive experience. Some exem- Cataract surgery plary units, including the one reporting in this issue, were used as examples of R P Wormald, A Foster best practice to form policies in the ‘‘Action on cataract’’ document. These ................................................................................... units show that despite many barriers, The times they are a changing progress can and has been made within the National Health Service. It is puz- zling why more effort has not been re our cataract surgical outcomes The cataract surgical rate (CSR, catar- made to disseminate and implement as good as they can get? If the act operations per million population per these examples of best practice. Aanswer is that there is still room year) in the United Kingdom is probably There is a separate point to consider for improvement, then how? between 4000 and 4500. This is about from Habib and colleagues’ article. The The outcome of cataract surgery is 100 operations per working week per authors were able to review complication determined by the patient, the techni- million population. If a rate of 8–10 cata- rates from a database of nearly 17 000 que, and the surgeon: the patient where ract operations per week is associated cases. Over time the complication rates there is coexisting morbidity; modern with a lower complication rate then 10– fell for those performing fewer than 400 techniques (most notably the implanta- 12 ‘‘cataract surgeons’’ are needed per operations per year as well as for those tion of an intraocular lens and probably million population.
[Show full text]
Untersuchung Von Transkriptionsunterschieden in Retina Und Gehirn Des Ccdc66-Defizienten Mausmodells
Aus der Abteilung für Humangenetik an der Medizinischen Fakultät der Ruhr-Universität Bochum Leiter: Prof. Dr. med. Jörg T. Epplen Untersuchung von Transkriptionsunterschieden in Retina und Gehirn des Ccdc66-defizienten Mausmodells Inaugural-Dissertation zur Erlangung des Doktorgrades der Medizin einer Hohen Medizinischen Fakultät der Ruhr-Universität Bochum vorgelegt von Elke Porrmann-Kelterbaum aus Gelsenkirchen 2017 Dekan: Prof. Dr. med. Albrecht Bufe Referent: Prof. Dr. med. Jörg T. Epplen Korreferent: Prof. Dr. rer. nat. Bernd Eiben Tag der mündlichen Prüfung: 07.06.2018 Meinen Kindern Meike, Sarah, Kristina und Tim Inhaltsverzeichnis 1 Einleitung .........................................................................................................9 1.1 Retinitis pigmentosa .................................................................................................... 9 1.2 Die Retina der Wirbeltiere ......................................................................................... 11 1.2.1 Aufbau der Retina ............................................................................................... 11 1.2.2 Photorezeptorzellen ............................................................................................ 14 1.2.3 Retinale Gliazellen .............................................................................................. 15 1.3 Die Retina der Maus als Modellsystem für retinale Erkrankungen ........................... 17 1.3.1 Histologische Merkmale .....................................................................................
[Show full text]
Mapping the Differential Distribution of Proteoglycan Core Proteins in the Adult Human Retina, Choroid, and Sclera
Anatomy and Pathology Mapping the Differential Distribution of Proteoglycan Core Proteins in the Adult Human Retina, Choroid, and Sclera Tiarnan D. L. Keenan,1,3,4 Simon J. Clark,1,4 Richard D. Unwin,4 Liam A. Ridge,2 Anthony J. Day,*,2 and Paul N. Bishop*,1,3,4 PURPOSE. To examine the presence and distribution of comprehensive analysis of the presence and distribution of proteoglycan (PG) core proteins in the adult human retina, PG core proteins throughout the human retina, choroid, and choroid, and sclera. sclera. This complements our knowledge of glycosaminoglycan chain distribution in the human eye, and has important METHODS. Postmortem human eye tissue was dissected into Bruch’s membrane/choroid complex, isolated Bruch’s mem- implications for understanding the structure and functional brane, or neurosensory retina. PGs were extracted and partially regulation of the eye in health and disease. (Invest Ophthalmol 2012;53:7528–7538) DOI:10.1167/iovs.12-10797 purified by anion exchange chromatography. Trypsinized Vis Sci. peptides were analyzed by tandem mass spectrometry and PG core proteins identified by database search. The distribu- roteoglycans (PGs) are present in mammalian tissues, both tion of PGs was examined by immunofluorescence microscopy Pon cell surfaces and in the extracellular matrix, where they on human macular tissue sections. play crucial roles in development, homeostasis, and disease.1,2 RESULTS. The basement membrane PGs perlecan, agrin, and PGs are composed of a core protein covalently bound to one or collagen-XVIII were identified in the human retina, and were more glycosaminoglycan (GAG) chains, where the core protein present in the internal limiting membrane, blood vessel walls, typically consists of multiple domains with distinct structural and Bruch’s membrane.
[Show full text]
Agricultural University of Athens
ΓΕΩΠΟΝΙΚΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΑΘΗΝΩΝ ΣΧΟΛΗ ΕΠΙΣΤΗΜΩΝ ΤΩΝ ΖΩΩΝ ΤΜΗΜΑ ΕΠΙΣΤΗΜΗΣ ΖΩΙΚΗΣ ΠΑΡΑΓΩΓΗΣ ΕΡΓΑΣΤΗΡΙΟ ΓΕΝΙΚΗΣ ΚΑΙ ΕΙΔΙΚΗΣ ΖΩΟΤΕΧΝΙΑΣ ΔΙΔΑΚΤΟΡΙΚΗ ΔΙΑΤΡΙΒΗ Εντοπισμός γονιδιωματικών περιοχών και δικτύων γονιδίων που επηρεάζουν παραγωγικές και αναπαραγωγικές ιδιότητες σε πληθυσμούς κρεοπαραγωγικών ορνιθίων ΕΙΡΗΝΗ Κ. ΤΑΡΣΑΝΗ ΕΠΙΒΛΕΠΩΝ ΚΑΘΗΓΗΤΗΣ: ΑΝΤΩΝΙΟΣ ΚΟΜΙΝΑΚΗΣ ΑΘΗΝΑ 2020 ΔΙΔΑΚΤΟΡΙΚΗ ΔΙΑΤΡΙΒΗ Εντοπισμός γονιδιωματικών περιοχών και δικτύων γονιδίων που επηρεάζουν παραγωγικές και αναπαραγωγικές ιδιότητες σε πληθυσμούς κρεοπαραγωγικών ορνιθίων Genome-wide association analysis and gene network analysis for (re)production traits in commercial broilers ΕΙΡΗΝΗ Κ. ΤΑΡΣΑΝΗ ΕΠΙΒΛΕΠΩΝ ΚΑΘΗΓΗΤΗΣ: ΑΝΤΩΝΙΟΣ ΚΟΜΙΝΑΚΗΣ Τριμελής Επιτροπή: Aντώνιος Κομινάκης (Αν. Καθ. ΓΠΑ) Ανδρέας Κράνης (Eρευν. B, Παν. Εδιμβούργου) Αριάδνη Χάγερ (Επ. Καθ. ΓΠΑ) Επταμελής εξεταστική επιτροπή: Aντώνιος Κομινάκης (Αν. Καθ. ΓΠΑ) Ανδρέας Κράνης (Eρευν. B, Παν. Εδιμβούργου) Αριάδνη Χάγερ (Επ. Καθ. ΓΠΑ) Πηνελόπη Μπεμπέλη (Καθ. ΓΠΑ) Δημήτριος Βλαχάκης (Επ. Καθ. ΓΠΑ) Ευάγγελος Ζωίδης (Επ.Καθ. ΓΠΑ) Γεώργιος Θεοδώρου (Επ.Καθ. ΓΠΑ) 2 Εντοπισμός γονιδιωματικών περιοχών και δικτύων γονιδίων που επηρεάζουν παραγωγικές και αναπαραγωγικές ιδιότητες σε πληθυσμούς κρεοπαραγωγικών ορνιθίων Περίληψη Σκοπός της παρούσας διδακτορικής διατριβής ήταν ο εντοπισμός γενετικών δεικτών και υποψηφίων γονιδίων που εμπλέκονται στο γενετικό έλεγχο δύο τυπικών πολυγονιδιακών ιδιοτήτων σε κρεοπαραγωγικά ορνίθια. Μία ιδιότητα σχετίζεται με την ανάπτυξη (σωματικό βάρος στις 35 ημέρες, ΣΒ) και η άλλη με την αναπαραγωγική
[Show full text]
(12) Patent Application Publication (10) Pub. No.: US 2004/0014040 A1 Mendrick Et Al
US 20040014040A1 (19) United States (12) Patent Application Publication (10) Pub. No.: US 2004/0014040 A1 Mendrick et al. (43) Pub. Date: Jan. 22, 2004 (54) CARDIOTOXIN MOLECULAR Related U.S. Application Data TOXCOLOGY MODELING (60) Provisional application No. 60/303,819, filed on Jul. (76) Inventors: Donna Mendrick, Gaithersburg, MD 10, 2001. Provisional application No. 60/305,623, (US); Mark Porter, Gaithersburg, MD filed on Jul. 17, 2001. Provisional application No. (US); Kory Johnson, Gaithersburg, MD 60/369,351, filed on Apr. 3, 2002. Provisional appli (US); Brandon Higgs, Gaithersburg, cation No. 60/377,611, filed on May 6, 2002. MD (US); Arthur Castle, Gaithersburg, Publication Classification MD (US); Michael Elashoff, Gaithersburg, MD (US) (51) Int. Cl. ............................ C12O 1/68; G06F 19/00; G01N 33/48; G01N 33/50 Correspondence Address: (52) U.S. Cl. ................................................... 435/6; 702/20 MORGAN LEWIS & BOCKUS LLP (57) ABSTRACT 1111 PENNSYLVANIAAVENUE NW The present invention is based on the elucidation of the WASHINGTON, DC 20004 (US) global changes in gene expression and the identification of toxicity markers in tissueS or cells exposed to a known cardiotoxin. The genes may be used as toxicity markers in (21) Appl. No.: 10/191,803 drug Screening and toxicity assays. The invention includes a database of genes characterized by toxin-induced differen tial expression that is designed for use with microarrays and (22) Filed: Jul. 10, 2002 other Solid-phase probes. US 2004/0014040 A1 Jan. 22, 2004 CARDIOTOXIN MOLECULAR TOXCOLOGY provided are methods of predicting the cellular pathways MODELING that a compound modulates in a cell.
[Show full text]
An Interplay of Microglia and Matrix Metalloproteinase MMP9 Under
www.nature.com/scientificreports OPEN An interplay of microglia and matrix metalloproteinase MMP9 under hypoxic stress regulates the opticin expression in retina Satish Patnaik1,2,6, Meenakshi Rai1,6, Subhadra Jalali3, Komal Agarwal3, Akshay Badakere4, Lavanya Puppala1, Sushma Vishwakarma1, Divya Balakrishnan3, Padmaja K. Rani3, Ramesh Kekunnaya4, Preeti Patil Chhablani4,5, Subhabrata Chakrabarti1 & Inderjeet Kaur1* Infammation plays a key role in the pathogenesis of retinal vascular diseases. We have shown earlier an increase in the activity of matrix metalloproteinases in the vitreous and tears of preterm born babies with retinopathy of prematurity (ROP) compared to those with no-ROP leading to a shift in the balance of angiogenic (vascular endothelial growth factor [VEGF], matrix metalloproteinase [MMPs], complement component [C3]) and anti-angiogenic (opticin, thrombospondin) in ROP eyes. We now confrmed that tear MMP levels in premature infants perfectly correlates with disease severity. Next, we demonstrated that a reduced opticin levels in ROP vitreous are regulated by MMPs secreted by activated microglia. Upon exposing the human microglia cell line (CHME3) to hypoxia, an increased expression of infammatory proteins (MMP9, VEGF) was noticed while opticin reduced signifcantly (p = 0.005). Further, the reduced opticin’s expression by microglial cells under hypoxia could be rescued by inhibiting the MMP activity using doxycycline and EDTA. The inhibition of MMP activity altered the expression of other key signaling molecules under
[Show full text]
Dedifferentiation and Redifferentiation of Canine Articular Chondrocytes
DEDIFFERENTIATION AND REDIFFERENTIATION OF CANINE ARTICULAR CHONDROCYTES JASMINE RACHEL PENNY, BSc. (Hons) Thesis submitted to the University of Nottingham for the degree of Doctor of Philosophy JULY 2015 1 Abstract Articular cartilage can be damaged directly through injury or osteoarthritis (OA). This tissue is very poor at regenerating itself due to its avascular nature and the immobility of chondrocytes within the tissue. There are a range of surgical techniques to repair cartilage lesions. Cellular therapies such Autologous Chondrocyte Implantation (ACI) and later modifications have been used to repair cartilage lesions for the past two decades. However, there is currently no completely successful treatment of cartilage lesions, with the newly generated cartilage often possessing very poor mechanical properties. Also, cell- based therapies require large numbers of chondrocytes which have to be expanded in monolayer. A consequence of this expansion is a loss of the chondrocyte phenotype (dedifferentiation). The overall aim of this thesis was to develop a greater understanding of chondrocyte dedifferentiation and redifferentiation in vitro using canine chondrocytes. Dogs can also suffer with OA and have been used extensively as a model for OA. Firstly, canine chondrocytes were expanded in monolayer up to P5 to confirm dedifferentiation. These cells were shown to have lost their typical chondrocytic phenotype through decreased expression of collagen type II and increased expression of collagen type I and CD44. A considerable part of this element of the thesis also involved identifying antibodies that would cross-react with the target canine antigens. The next aim of the thesis was to 1 redifferentiate dedifferentiated chondrocytes through three-dimensional (3D) culture.
[Show full text]
Vitreous Biochemistry and Pharmacologic Vitreolysis J
CHAPTER 4 Vitreous Biochemistry and Pharmacologic Vitreolysis J. Sebag and Kevin R. Tozer Throughout history, medical therapeutics have advanced condition (2). Thus, in vitreous as elsewhere, great care as a result of increased understanding of disease patho- must be taken when extrapolating from the adult to the genesis. With limited knowledge, little could be done. As diseased child. knowledge increased, surgical procedures were histori- This chapter reviews the biochemical composi- cally early therapeutic approaches. Further increases in tion and organization of the human vitreous (4–6) and, knowledge saw surgical treatments replaced by medical where information is available, describes differences (usually pharmacologic) therapies. Advanced under- between adults and in youth. A review of the various standing of disease pathogenesis leads to prevention, agents being developed for pharmacologic vitreolysis the ultimate goal of medicine. Vitreoretinal surgery is a will also be presented. paradigm of this evolution. The end of the last millen- nium witnessed the development of revolutionary sur- gical approaches to treat vitreoretinal diseases—scleral VITREOUS BIOCHEMISTRY buckle and vitrectomy. At present, expanding knowledge of the biochemistry, structure, and pathophysiology of Vitreous is an extended extracellular matrix composed vitreous and the vitreoretinal interface is enabling drug of 98% water and 2% structural components, primarily therapies such as pharmacologic vitreolysis (1,2). Ini- collagens and glycosaminoglycans (GAGs). tially, this approach will be used as an adjunct to facili- tate and enhance surgery. The next implementation Collagens phase, which has already begun (3), will replace surgery Collagen content is highest where the vitreous is a gel to treat vitreomacular diseases. Ultimately, pharmaco- (7).
[Show full text]