OPTC polyclonal antibody Gene Alias: OPT Catalog Number: PAB22838 Gene Summary: Opticin belongs to class III of the small leucine-rich repeat protein (SLRP) family. Members of Regulatory Status: For research use only (RUO) this family are typically associated with the extracellular matrix. Opticin is present in significant quantities in the Product Description: Rabbit polyclonal antibody raised vitreous of the eye and also localizes to the cornea, iris, against recombinant OPTC. ciliary body, optic nerve, choroid, retina, and fetal liver. Opticin may noncovalently bind collagen fibrils and Immunogen: Recombinant protein corresponding to regulate fibril morphology, spacing, and organization. amino acids of human OPTC. The opticin gene is mapped to a region of chromosome 1 that is associated with the inherited eye diseases Sequence: age-related macular degeneration (AMD) and posterior RIDLSNNLISSIDNDAFRLLHALQDLILPENQLEALPVLP column ataxia with retinosa pigmentosa (AXPC1). SGIEFLDVRLNRLQSSGIQPAAFRAMEKLQFLYLSDNL [provided by RefSeq] LDSIP Host: Rabbit Reactivity: Human Applications: IHC-P (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Form: Liquid Purification: Antigen affinity purification Isotype: IgG Recommend Usage: Immunohistochemistry (1:20-1:50) The optimal working dilution should be determined by the end user. Storage Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) Storage Instruction: Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 26254 Gene Symbol: OPTC Page 1/1 Powered by TCPDF (www.tcpdf.org).