DOCSLIB.ORG

LGALS3BP, Lectin Galactoside-Binding Soluble 3 Binding Protein, Induces Vascular Endothelial Growth Factor in Human Breast Cancer Cells and Promotes Angiogenesis

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
LGALS3BP, Lectin Galactoside-Binding Soluble 3 Binding Protein, Induces Vascular Endothelial Growth Factor in Human Breast Cancer Cells and Promotes Angiogenesis J Mol Med DOI 10.1007/s00109-012-0936-6 ORIGINAL ARTICLE LGALS3BP, lectin galactoside-binding soluble 3 binding protein, induces vascular endothelial growth factor in human breast cancer cells and promotes angiogenesis Enza Piccolo & Nicola Tinari & Daniela Semeraro & Sara Traini & Imma Fichera & Albana Cumashi & Rossana La Sorda & Francesca Spinella & Anna Bagnato & Rossano Lattanzio & Maurizia D’Egidio & Annalisa Di Risio & Pavlos Stampolidis & Mauro Piantelli & Clara Natoli & Axel Ullrich & Stefano Iacobelli Received: 3 May 2012 /Revised: 6 July 2012 /Accepted: 17 July 2012 # Springer-Verlag 2012 Abstract Elevated serum or tissue levels of lectin galactoside- migration and, more importantly, a reduced expression of binding soluble 3 binding protein (LGALS3BP) have been vascular endothelial growth factor (VEGF). Production of associated with short survival and development of metastasis VEGF, that was restored by exposure of silenced cells to in a variety of human cancers. However, the role of recombinant LGALS3BP, required an intact PI3k/Akt signal- LGALS3BP, particularly in the context of tumor–host relation- ing. Furthermore, we show that LGALS3BP was able to ships, is still missing. Here, we show that LGALS3BP knock- directly stimulate HUVEC tubulogenesis in a VEGF- down in MDA-MB-231 human breast cancer cells leads to a independent, galectin-3-dependent manner. Immunohisto- decreased adhesion to fibronectin, a reduced transendothelial chemical analysis of human breast cancer tissues revealed a correlation among LGALS3BP expression, VEGF expression, and blood vessel density. We propose that in addition to its prometastatic role, LGALS3BP secreted by breast cancer cells Electronic supplementary material The online version of this article (doi:10.1007/s00109-012-0936-6) contains supplementary material, functions critically as a pro-angiogenic factor through a dual which is available to authorized users. mechanism, i.e by induction of tumor VEGF and stimulation of endothelial cell tubulogenesis. E. Piccolo : N. Tinari : S. Traini : R. La Sorda : M. D’Egidio : A. Di Risio : M. Piantelli : C. Natoli : S. Iacobelli MediaPharma s.r.l., Keywords Angiogenesis . VEGF . LGALS3BP . Via Colle dell’Ara, Extracellular matrix . Galectin-3 Chieti, Italy E. Piccolo (*) : N. Tinari : D. Semeraro : S. Traini : I. Fichera : : : : ’ : A. Cumashi: R. La Sorda: R. Lattanzio: M. D Egidio A. Di Risio M. Piantelli C. Natoli S. Iacobelli Introduction Department of Biomedical Sciences, “G. d’Annunzio” University and Foundation, Via dei Vestini, 66100 Chieti, Italy The development of human cancer is a multistep pro- e-mail: [email protected] cess characterized by the accumulation of progressive : genetic alterations that confer to tumor cells the ability F. Spinella A. Bagnato to survive, proliferate, and metastasize. Once they have Laboratory of Molecular Pathology, Regina Elena National Cancer Institute, expanded to a critical level, tumor cells find a way to Rome, Italy promote new vasculature development, a process known : as tumor angiogenesis in order to progress and metas- P. Stampolidis A. Ullrich tasize [1]. This "angiogenic switch" can occur at differ- Department of Molecular Biology, Max Planck Institute of Biochemistry, ent stages of tumor progression and is dictated by an Martinsried/Munich, Germany imbalance between factors that either induce or oppose J Mol Med angiogenesis in favor of the former [2]. Vascular endo- heat-inactivated FBS supplemented with EGM-2 Single- thelial growth factor (VEGF) represents the prototypical Quots (Lonza, Basel, Switzerland). pro-angiogenic factor [3]. Although hypoxia appears to For transfection of HUVEC, siRNA duplexes directed be the main driver of tumor angiogenesis, growth fac- against human galectin-3 or nontargeting siRNA duplex or tors and inflammation are able to boost VEGF produc- siRNA duplexes against human VEGF (Thermo Scientific, tion through paracrine or autocrine mechanisms [4, 5]. Waltham, MA, USA) were used according to the manufac- However, much more remains to be understood about turer’s instructions. SiRNA duplexes against LGALS3BP the molecular nature of unidentified factors that are also were obtained from Qiagen (Qiagen, Hilden, Germany). believed to have the ability to promote angiogenesis in For collection of the conditioned media (CM), cells were the development of a variety of human cancers. grown until 70 % confluent. The next day, the medium was LGALS3BP (also known as 90 K or Mac-2 BP) is a large replaced with serum-free medium after washing with oligomeric glycoprotein composed of 90-kDa subunits that phosphate-buffered saline (PBS). The medium was collected was originally identified as a tumor-secreted antigen [6]andas 24–48 h later and centrifuged at 1,200 rpm for 15 min to a ligand of the lactose-specific S-type lectin, galectin-3 (for- remove cells and debris. merly Mac-2) [7]. Over the past decade, considerable attention has been focused on a potential role of LGALS3BP in the LGALS3BP gene knockdown development of human cancer. Immunohistochemical and gene expression analysis showed significantly higher levels A 21-nucleotide sequence corresponding to nucleotide of LGALS3BP in different types of human malignancies [8]. 2216-2236 of human LGALS3BP mRNA (NCBI Acces- Furthermore, clinical studies have revealed that elevated se- sion NM-005567.3) or a 21-nucleotide sequence with no rum or tumor tissue levels of LGALS3BP are associated with significant homology to any mammalian gene sequence a shorter survival in patients with breast carcinoma [9, 10], serving as a non-silencing control (OligoEngine, Hercules, lymphoma [11], pleural mesothelioma [12], and non-small CA, USA) was inserted into the pSUPER.retro.puro (Oli- cell lung carcinoma [13]. goEngine, Hercules, CA, USA). After transformation into Taken together, these data indicate that expression levels DH5α competent cells (Invitrogen, Carlsbad, CA, USA), of LGALS3BP may serve as a prognostic indicator. None- the recombinant plasmids were confirmed by PCR ampli- theless, little is known regarding LGALS3BP activity in fication, restriction enzymes digestion, and DNA sequenc- human cancers. ing. The generation of knockdown cells was performed as In the current study, we tested the hypothesis that previously described [14]. LGALS3BP acts as a pro-angiogenic factor. We find and report for the first time that LGALS3BP induces VEGF ex- pression in human breast cancer cells by activation of the Production of recombinant LGALS3BP PI3k/Akt pathway. Furthermore, we show that LGALS3BP directly acts on endothelial cells, promoting angiogenesis in Recombinant LGALS3BP was immunoaffinity-purified from vitro and in vivo in a VEGF-independent, galectin-3- free supernatant of human embryonic kidney EBNA-293 cells dependent manner. (Invitrogen) [15] transfected with LGALS3BP cDNA [16]. Quantitative real-time PCR Materials and methods Total RNA was extracted using the RNeasy mini kit Cell lines and culture (Qiagen), quantified by optical density, and checked for quality by gel electrophoresis. RNA was reverse- The estrogen receptor (ER)-negative human breast cancer transcribed with cDNA High Capacity kit (Applied Bio- cell lines MDA-MB 231 and SK-BR-3 and the ER-positive system, Foster City, CA, USA) according to the manu- MCF-7 and T47D were purchased from American Type facturer's instructions. Quantitative real-time PCR was Culture Collection (Rockville, MD, USA). Cells were main- performed using 96-well optic plates on an ABI Prism tained in Dulbecco’s modified Eagle’s medium (Invitrogen, 7500 Sequence Detection System (Applied Biosystems). Carlsbad, CA, USA) with 10 % heat-inactivated fetal bovine ThepredevelopedTaqManassayreagentsofhuman serum (FBS; Invitrogen, Carlsbad, CA, USA), L-glutamine, VEGF (ID: Hs00173626_ m1) and human LGALS3BP and antibiotics (Sigma Aldrich Corporation, St. Louis, MO, (ID: Hs00174774_ m1) were used according to the man- USA). The human umbilical vein endothelial cells ufacturer's instructions. Relative expression values were (HUVEC) were purchased from Lonza (Lonza, Basel, Swit- obtained using the Q-Gene software and normalized to zerland) and maintained in EBM-2 medium containing 10 % the expression of GAPDH (ID: Hs0017266705g1). J Mol Med Confocal microscopy and spreading assay microscope and counted from ten random fields of ×200 magnification. MDA-MB-231 cells and HUVEC grown on coverslips were treated as indicated, fixed in 4 % paraformaldehyde for Enzyme-linked immunosorbent assay 15 min at room temperature, permeabilized with 0.25 % Triton X-100 for 5 min, and blocked with 0.1 % bovine Sandwich enzyme-linked immunosorbent assay (ELISA) was serum albumin for 1 h at room temperature. Coverslips were performed using kits specific for VEGF-A (Invitrogen) and then incubated for 2 h at room temperature with the indicat- LGALS3BP (Diesse, Siena, Italy) in accordance with the ed primary antibodies, followed by Alexa Fluor specific manufacturers’ instructions. secondary antibodies (Molecular Probes, Life Technologies, Paisley, UK). TRITC-labeled phalloidin was used to visual- Tubulogenesis assay ize actin cytoskeleton; DRAQ5 (Vinci-Biochem, Firenze, Italy) was used to visualize nuclei. Images were acquired Capillary tube formation (tubulogenesis) assay was per- with the Zeiss LSM 510 meta-confocal microscope (Zeiss, formed as described [18] with a few modifications. HUVEC Oberkochen, Germany) using 488-, 543-, and 633-nm were resuspended in a serum-free EBM-2 or the indicated lasers. CMs and seeded
Load more

Recommended publications
  • Datasheet A02938-1 Anti-LGALS3BP Antibody
    Product datasheet Anti-LGALS3BP Antibody Catalog Number: A02938-1 BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected] Basic Information Product Name Anti-LGALS3BP Antibody Gene Name LGALS3BP Source Rabbit IgG Species Reactivity human,mouse Tested Application WB,IHC-P Contents 500ug/ml antibody with PBS ，0.02% NaN3 , 1mg BSA and 50% glycerol. Immunogen A synthetic peptide corresponding to a sequence of human LGALS3BP (HEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPR). Purification Immunogen affinity purified. Observed MW 65KD Dilution Ratios Western blot: 1:500-2000 Immunohistochemistry in paraffin section: 1:50-400 (Boiling the paraffin sections in 10mM citrate buffer,pH6.0,or PH8.0 EDTA repair liquid for 20 mins is required for the staining of formalin/paraffin sections.) Optimal working dilutions must be determined by end user. Storage 12 months from date of receipt，-20℃ as supplied.6 months 2 to 8℃ after reconstitution. Avoid repeated freezing and thawing Background Information Galectin-3-binding protein is a protein that in humans is encoded by the LGALS3BP gene. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Using fluorescence in situ hybridization the full length 90K cDNA has been localized to chromosome 17q25.
    [Show full text]
  • Pancreatic Cancer Invasion of the Lymphatic Vasculature and Contributions of the Tumor Microenvironment: Roles for E- Selectin and CXCR4
    University of Nebraska Medical Center DigitalCommons@UNMC Theses & Dissertations Graduate Studies Fall 12-16-2016 Pancreatic Cancer Invasion of the Lymphatic Vasculature and Contributions of the Tumor Microenvironment: Roles for E- selectin and CXCR4 Maria M. Steele University of Nebraska Medical Center Follow this and additional works at: https://digitalcommons.unmc.edu/etd Recommended Citation Steele, Maria M., "Pancreatic Cancer Invasion of the Lymphatic Vasculature and Contributions of the Tumor Microenvironment: Roles for E-selectin and CXCR4" (2016). Theses & Dissertations. 166. https://digitalcommons.unmc.edu/etd/166 This Dissertation is brought to you for free and open access by the Graduate Studies at DigitalCommons@UNMC. It has been accepted for inclusion in Theses & Dissertations by an authorized administrator of DigitalCommons@UNMC. For more information, please contact [email protected]. i PANCREATIC CANCER INVASION OF THE LYMPHATIC VASCULATURE AND CONTRIBUTIONS OF THE TUMOR MICROENVIRONMENT: ROLES FOR E-SELECTIN AND CXCR4 By Maria M. Steele A DISSERTATION Presented to the Faculty of the University of Nebraska Graduate College in Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy Cancer Research Graduate Program Under the Supervision of Professor Michael A. Hollingsworth University of Nebraska Medical Center Omaha, NE November, 2016 Supervisory Committee Michael A. Hollingsworth, Ph.D. Kaustubh Datta, Ph.D. Angie Rizzino, Ph.D. Joyce C. Solheim, Ph.D. ii PANCREATIC CANCER INVASION OF THE LYMPHATIC VASCULATURE AND CONTRIBUTIONS OF THE TUMOR MICROENVIRONMENT: ROLES FOR E-SELECTIN AND CXCR4 Maria M. Steele University of Nebraska, 2016 Advisor: Michael A. Hollingsworth ABSTRACT As the fourth leading cause of cancer-related deaths, pancreatic cancer is one of the most lethal forms of cancers in the United States.
    [Show full text]
  • King's Research Portal
    King’s Research Portal DOI: 10.3892/ijo.2016.3521 Document Version Peer reviewed version Link to publication record in King's Research Portal Citation for published version (APA): Woodman, N., Pinder, S. E., Tajadura, V., Le Bourhis, X., Gillett, C., Delannoy, P., Burchell, J. M., & Julien, S. (2016). Two E-selectin ligands, BST-2 and LGALS3BP, predict metastasis and poor survival of ER-negative breast cancer. International Journal of Oncology, 49(1), 265-275. https://doi.org/10.3892/ijo.2016.3521 Citing this paper Please note that where the full-text provided on King's Research Portal is the Author Accepted Manuscript or Post-Print version this may differ from the final Published version. If citing, it is advised that you check and use the publisher's definitive version for pagination, volume/issue, and date of publication details. And where the final published version is provided on the Research Portal, if citing you are again advised to check the publisher's website for any subsequent corrections. General rights Copyright and moral rights for the publications made accessible in the Research Portal are retained by the authors and/or other copyright owners and it is a condition of accessing publications that users recognize and abide by the legal requirements associated with these rights. •Users may download and print one copy of any publication from the Research Portal for the purpose of private study or research. •You may not further distribute the material or use it for any profit-making activity or commercial gain •You may freely distribute the URL identifying the publication in the Research Portal Take down policy If you believe that this document breaches copyright please contact [email protected] providing details, and we will remove access to the work immediately and investigate your claim.
    [Show full text]
  • LGALS3BP Rabbit Pab
    Leader in Biomolecular Solutions for Life Science LGALS3BP Rabbit pAb Catalog No.: A12005 Basic Information Background Catalog No. The galectins are a family of beta-galactoside-binding proteins implicated in A12005 modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency Observed MW virus (HIV). It appears to be implicated in immune response associated with natural killer 70kDa (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Using fluorescence in situ hybridization the full length 90K cDNA has been localized to chromosome 17q25. The Calculated MW native protein binds specifically to a human macrophage-associated lectin known as 65kDa Mac-2 and also binds galectin 1. Category Primary antibody Applications WB Cross-Reactivity Human, Mouse Recommended Dilutions Immunogen Information WB 1:500 - 1:2000 Gene ID Swiss Prot 3959 Q08380 Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 6-221 of human LGALS3BP (NP_005558.1). Synonyms LGALS3BP;90K;BTBD17B;CyCAP;M2BP;MAC-2-BP;TANGO10B;gp90 Contact Product Information www.abclonal.com Source Isotype Purification Rabbit IgG Affinity purification Storage Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide,50% glycerol,pH7.3. Validation Data Western blot analysis of extracts of various cell lines, using LGALS3BP antibody (A12005) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.
    [Show full text]
  • Human Lectins, Their Carbohydrate Affinities and Where to Find Them
    biomolecules Review Human Lectins, Their Carbohydrate Affinities and Where to Review HumanFind Them Lectins, Their Carbohydrate Affinities and Where to FindCláudia ThemD. Raposo 1,*, André B. Canelas 2 and M. Teresa Barros 1 1, 2 1 Cláudia D. Raposo * , Andr1 é LAQVB. Canelas‐Requimte,and Department M. Teresa of Chemistry, Barros NOVA School of Science and Technology, Universidade NOVA de Lisboa, 2829‐516 Caparica, Portugal; [email protected] 12 GlanbiaLAQV-Requimte,‐AgriChemWhey, Department Lisheen of Chemistry, Mine, Killoran, NOVA Moyne, School E41 of ScienceR622 Co. and Tipperary, Technology, Ireland; canelas‐ [email protected] NOVA de Lisboa, 2829-516 Caparica, Portugal; [email protected] 2* Correspondence:Glanbia-AgriChemWhey, [email protected]; Lisheen Mine, Tel.: Killoran, +351‐212948550 Moyne, E41 R622 Tipperary, Ireland; [email protected] * Correspondence: [email protected]; Tel.: +351-212948550 Abstract: Lectins are a class of proteins responsible for several biological roles such as cell‐cell in‐ Abstract:teractions,Lectins signaling are pathways, a class of and proteins several responsible innate immune for several responses biological against roles pathogens. such as Since cell-cell lec‐ interactions,tins are able signalingto bind to pathways, carbohydrates, and several they can innate be a immuneviable target responses for targeted against drug pathogens. delivery Since sys‐ lectinstems. In are fact, able several to bind lectins to carbohydrates, were approved they by canFood be and a viable Drug targetAdministration for targeted for drugthat purpose. delivery systems.Information In fact, about several specific lectins carbohydrate were approved recognition by Food by andlectin Drug receptors Administration was gathered for that herein, purpose. plus Informationthe specific organs about specific where those carbohydrate lectins can recognition be found by within lectin the receptors human was body.
    [Show full text]
  • Supplementary Material Contents
    Supplementary Material Contents Immune modulating proteins identified from exosomal samples.....................................................................2 Figure S1: Overlap between exosomal and soluble proteomes.................................................................................... 4 Bacterial strains:..............................................................................................................................................4 Figure S2: Variability between subjects of effects of exosomes on BL21-lux growth.................................................... 5 Figure S3: Early effects of exosomes on growth of BL21 E. coli .................................................................................... 5 Figure S4: Exosomal Lysis............................................................................................................................................ 6 Figure S5: Effect of pH on exosomal action.................................................................................................................. 7 Figure S6: Effect of exosomes on growth of UPEC (pH = 6.5) suspended in exosome-depleted urine supernatant ....... 8 Effective exosomal concentration....................................................................................................................8 Figure S7: Sample constitution for luminometry experiments..................................................................................... 8 Figure S8: Determining effective concentration .........................................................................................................
    [Show full text]
  • Deciphering the Molecular Profile of Plaques, Memory Decline And
    ORIGINAL RESEARCH ARTICLE published: 16 April 2014 AGING NEUROSCIENCE doi: 10.3389/fnagi.2014.00075 Deciphering the molecular profile of plaques, memory decline and neuron loss in two mouse models for Alzheimer’s disease by deep sequencing Yvonne Bouter 1†,Tim Kacprowski 2,3†, Robert Weissmann4, Katharina Dietrich1, Henning Borgers 1, Andreas Brauß1, Christian Sperling 4, Oliver Wirths 1, Mario Albrecht 2,5, Lars R. Jensen4, Andreas W. Kuss 4* andThomas A. Bayer 1* 1 Division of Molecular Psychiatry, Georg-August-University Goettingen, University Medicine Goettingen, Goettingen, Germany 2 Department of Bioinformatics, Institute of Biometrics and Medical Informatics, University Medicine Greifswald, Greifswald, Germany 3 Department of Functional Genomics, Interfaculty Institute for Genetics and Functional Genomics, University Medicine Greifswald, Greifswald, Germany 4 Human Molecular Genetics, Department for Human Genetics of the Institute for Genetics and Functional Genomics, Institute for Human Genetics, University Medicine Greifswald, Ernst-Moritz-Arndt University Greifswald, Greifswald, Germany 5 Institute for Knowledge Discovery, Graz University of Technology, Graz, Austria Edited by: One of the central research questions on the etiology of Alzheimer’s disease (AD) is the Isidro Ferrer, University of Barcelona, elucidation of the molecular signatures triggered by the amyloid cascade of pathological Spain events. Next-generation sequencing allows the identification of genes involved in disease Reviewed by: Isidro Ferrer, University of Barcelona, processes in an unbiased manner. We have combined this technique with the analysis of Spain two AD mouse models: (1) The 5XFAD model develops early plaque formation, intraneu- Dietmar R. Thal, University of Ulm, ronal Ab aggregation, neuron loss, and behavioral deficits. (2)TheTg4–42 model expresses Germany N-truncated Ab4–42 and develops neuron loss and behavioral deficits albeit without plaque *Correspondence: formation.
    [Show full text]
  • LGALS3BP Mouse Monoclonal Antibody [Clone ID: OTI1C2] Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for CF503456 LGALS3BP Mouse Monoclonal Antibody [Clone ID: OTI1C2] Product data: Product Type: Primary Antibodies Clone Name: OTI1C2 Applications: FC, IF, WB Recommended Dilution: WB 1:2000, IF 1:100, FLOW 1:100 Reactivity: Human Host: Mouse Isotype: IgG1 Clonality: Monoclonal Immunogen: Human recombinant protein fragment corresponding to amino acids 19-300 of human LGALS3BP(NP_005558) produced in E.coli. Formulation: Lyophilized powder (original buffer 1X PBS, pH 7.3, 8% trehalose) Reconstitution Method: For reconstitution, we recommend adding 100uL distilled water to a final antibody concentration of about 1 mg/mL. To use this carrier-free antibody for conjugation experiment, we strongly recommend performing another round of desalting process. (OriGene recommends Zeba Spin Desalting Columns, 7KMWCO from Thermo Scientific) Purification: Purified from mouse ascites fluids or tissue culture supernatant by affinity chromatography (protein A/G) Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 65.2 kDa Gene Name: Homo sapiens galectin 3 binding protein (LGALS3BP), mRNA. Database Link: NP_005558 Entrez Gene 3959 Human Q08380 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 LGALS3BP Mouse Monoclonal Antibody [Clone ID: OTI1C2] – CF503456 Background: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell- cell and cell-matrix interactions.
    [Show full text]
  • LGALS3BP Antibody
    LGALS3BP Antibody CATALOG NUMBER: 26-926 Antibody used in WB on Human Brain at 0.2-1 ug/ml. Specifications SPECIES REACTIVITY: Human, Mouse TESTED APPLICATIONS: ELISA, WB APPLICATIONS: LGALS3BP antibody can be used for detection of LGALS3BP by ELISA at 1:312500. LGALS3BP antibody can be used for detection of LGALS3BP by western blot at 1 ug/mL, and HRP conjugated secondary antibody should be diluted 1:50,000 - 100,000. USER NOTE: Optimal dilutions for each application to be determined by the researcher. POSITIVE CONTROL: 1) Cat. No. XBL-10123 - Fetal Brain Tissue Lysate PREDICTED MOLECULAR 63 kDa WEIGHT: IMMUNOGEN: Antibody produced in rabbits immunized with a synthetic peptide corresponding a region of human LGALS3BP. HOST SPECIES: Rabbit Properties PURIFICATION: Antibody is purified by peptide affinity chromatography method. PHYSICAL STATE: Lyophilized BUFFER: Antibody is lyophilized in PBS buffer with 2% sucrose. Add 50 uL of distilled water. Final antibody concentration is 1 mg/mL. CONCENTRATION: 1 mg/ml STORAGE CONDITIONS: For short periods of storage (days) store at 4˚C. For longer periods of storage, store LGALS3BP antibody at - 20˚C. As with any antibody avoid repeat freeze-thaw cycles. CLONALITY: Polyclonal CONJUGATE: Unconjugated Additional Info ALTERNATE NAMES: LGALS3BP, 90K, MAC-2-BP, BTBD17B, TANGO10B ACCESSION NO.: NP_005558 PROTEIN GI NO.: 5031863 OFFICIAL SYMBOL: LGALS3BP GENE ID: 3959 Background BACKGROUND: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV).
    [Show full text]
  • The N-Terminal Domain of the Spike Protein As Another Emerging Target for Hampering the SARS-Cov-2 Attachment to Host Cells
    International Journal of Molecular Sciences Perspective More Is Always Better Than One: The N-Terminal Domain of the Spike Protein as Another Emerging Target for Hampering the SARS-CoV-2 Attachment to Host Cells Sonia Di Gaetano 1,2,† , Domenica Capasso 2,3,† , Pietro Delre 4,5, Luciano Pirone 1 , Michele Saviano 2,4, Emilia Pedone 1,2,* and Giuseppe Felice Mangiatordi 4 1 Institute of Biostructures and Bioimaging, CNR, 80134 Naples, Italy; [email protected] (S.D.G.); [email protected] (L.P.) 2 CIRPEB, University of Naples “Federico II”, 80134 Naples, Italy; [email protected] (D.C.); [email protected] (M.S.) 3 CESTEV, University of Naples “Federico II”, 80145 Naples, Italy 4 Institute of Crystallography, CNR, 70126 Bari, Italy; [email protected] (P.D.); [email protected] (G.F.M.) 5 Chemistry Department, University of Bari, 70121 Bari, Italy * Correspondence: [email protected]; Tel.: +39-081-253-4521 † The authors contribute equally to this work. Abstract: Although the approved vaccines are proving to be of utmost importance in containing the Coronavirus disease 2019 (COVID-19) threat, they will hardly be resolutive as new severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2, a single-stranded RNA virus) variants might be Citation: Di Gaetano, S.; Capasso, D.; insensitive to the immune response they induce. In this scenario, developing an effective therapy is Delre, P.; Pirone, L.; Saviano, M.; still a dire need. Different targets for therapeutic antibodies and diagnostics have been identified, Pedone, E.; Mangiatordi, G.F. More Is among which the SARS-CoV-2 spike (S) glycoprotein, particularly its receptor-binding domain, has Always Better Than One: The been defined as crucial.
    [Show full text]
  • LGALS3BP Mouse Monoclonal Antibody [Clone ID: OTI1C2] Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA503456 LGALS3BP Mouse Monoclonal Antibody [Clone ID: OTI1C2] Product data: Product Type: Primary Antibodies Clone Name: OTI1C2 Applications: FC, IF, WB Recommended Dilution: WB 1:2000, IF 1:100, FLOW 1:100 Reactivity: Human Host: Mouse Isotype: IgG1 Clonality: Monoclonal Immunogen: Human recombinant protein fragment corresponding to amino acids 19-300 of human LGALS3BP(NP_005558) produced in E.coli. Formulation: PBS (PH 7.3) containing 1% BSA, 50% glycerol and 0.02% sodium azide. Concentration: 1 mg/ml Purification: Purified from mouse ascites fluids or tissue culture supernatant by affinity chromatography (protein A/G) Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 65.2 kDa Gene Name: galectin 3 binding protein Database Link: NP_005558 Entrez Gene 3959 Human Q08380 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 LGALS3BP Mouse Monoclonal Antibody [Clone ID: OTI1C2] – TA503456 Background: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell- cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine- activated killer (LAK) cell cytotoxicity.
    [Show full text]
  • GSE50161, (C) GSE66354, (D) GSE74195 and (E) GSE86574
    Figure S1. Boxplots of normalized samples in five datasets. (A) GSE25604, (B) GSE50161, (C) GSE66354, (D) GSE74195 and (E) GSE86574. The x‑axes indicate samples, and the y‑axes represent the expression of genes. Figure S2. Volanco plots of DEGs in five datasets. (A) GSE25604, (B) GSE50161, (C) GSE66354, (D) GSE74195 and (E) GSE86574. Red nodes represent upregulated DEGs and green nodes indicate downregulated DEGs. Cut‑off criteria were P<0.05 and |log2 FC|>1. DEGs, differentially expressed genes; FC, fold change; adj.P.Val, adjusted P‑value. Figure S3. Transcription factor‑gene regulatory network constructed using the Cytoscape iRegulion plug‑in. Table SI. Primer sequences for reverse transcription‑quantitative polymerase chain reaction. Genes Sequences hsa‑miR‑124 F: 5'‑ACACTCCAGCTGGGCAGCAGCAATTCATGTTT‑3' R: 5'‑CTCAACTGGTGTCGTGGA‑3' hsa‑miR‑330‑3p F: 5'‑CATGAATTCACTCTCCCCGTTTCTCCCTCTGC‑3' R: 5'‑CCTGCGGCCGCGAGCCGCCCTGTTTGTCTGAG‑3' hsa‑miR‑34a‑5p F: 5'‑TGGCAGTGTCTTAGCTGGTTGT‑3' R: 5'‑GCGAGCACAGAATTAATACGAC‑3' hsa‑miR‑449a F: 5'‑TGCGGTGGCAGTGTATTGTTAGC‑3' R: 5'‑CCAGTGCAGGGTCCGAGGT‑3' CD44 F: 5'‑CGGACACCATGGACAAGTTT‑3' R: 5'‑TGTCAATCCAGTTTCAGCATCA‑3' PCNA F: 5'‑GAACTGGTTCATTCATCTCTATGG‑3' F: 5'‑TGTCACAGACAAGTAATGTCGATAAA‑3' SYT1 F: 5'‑CAATAGCCATAGTCGCAGTCCT‑3' R: 5'‑TGTCAATCCAGTTTCAGCATCA‑3' U6 F: 5'‑GCTTCGGCAGCACATATACTAAAAT‑3' R: 5'‑CGCTTCACGAATTTGCGTGTCAT‑3' GAPDH F: 5'‑GGAAAGCTGTGGCGTGAT‑3' R: 5'‑AAGGTGGAAGAATGGGAGTT‑3' hsa, homo sapiens; miR, microRNA; CD44, CD44 molecule (Indian blood group); PCNA, proliferating cell nuclear antigen;
    [Show full text]