Multimodal Single-Cell/Nucleus RNA Sequencing Data Analysis Uncovers Molecular Networks Between Disease-Associated Microglia
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
PSPC1 Potentiates IGF1R Expression to Augment Cell Adhesion and Motility
1 Supplementary information 2 PSPC1 potentiates IGF1R expression to augment cell 3 adhesion and motility 4 Hsin-Wei Jen1,2 , De-Leung Gu 2, Yaw-Dong Lang 2 and Yuh-Shan Jou 1,2,* 5 1 Graduate Institute of Life Sciences, National Defense Medical Center, Taipei, Taiwan 6 2 Institute of Biomedical Sciences, Academia Sinica, Taipei, Taiwan 7 * Author to whom correspondence should be addressed 8 Cells 2020, 9, x; doi: FOR PEER REVIEW www.mdpi.com/journal/cells Cells 2020, 9, x FOR PEER REVIEW 2 of 10 9 10 11 Supplementary Figure S1: Expression of IGF1R and integrin in PSPC1-expressing or PSPC1-depleted 12 HCC cells by Western blotting analysis 13 (A) Detection of IGF1R protein levels in three PSPC1-knockdown cells Huh7, HepG2 and Mahlavu. (B) 14 Detection of selected integrin expression in PSPC1-overexpressing or PSPC1-depleted HCC cells by using 15 their total cell lysates immunoblotted with specific integrin antibodies as shown. 16 17 18 Supplementary Figure S2: PSPC1-modulated IGF1R downstream signaling in HCC cells. Cells 2020, 9, x FOR PEER REVIEW 3 of 10 19 (A, B) Immunoblotting of IGF1R expression in PSPC1-overexpressing SK-Hep1 and PLC5 cells 20 treated with IGF1R shRNAs. (C, D) Cell migration and adhesion were measured in PSPC1- 21 knockdown Hep3B cells rescued with exogenous expression of IGF1R. Exogenous expression of 22 IGF1R in PSPC1-knockdown Hep3B cells were then applied for detection of altered AKT/ERK 23 signaling including (E) total PSPC1, IGF1R, AKT, ERK, p-IGF1R, p-AKT(S473), and 24 p-ERK(T202/Y204) as well as altered FAK/Src signaling including (F) total FAK, Src, p-FAK(Y397) 25 and p-Src(Y416) by immunoblotting assay. -
Cyclin D1/Cyclin-Dependent Kinase 4 Interacts with Filamin a and Affects the Migration and Invasion Potential of Breast Cancer Cells
Published OnlineFirst February 28, 2010; DOI: 10.1158/0008-5472.CAN-08-1108 Tumor and Stem Cell Biology Cancer Research Cyclin D1/Cyclin-Dependent Kinase 4 Interacts with Filamin A and Affects the Migration and Invasion Potential of Breast Cancer Cells Zhijiu Zhong, Wen-Shuz Yeow, Chunhua Zou, Richard Wassell, Chenguang Wang, Richard G. Pestell, Judy N. Quong, and Andrew A. Quong Abstract Cyclin D1 belongs to a family of proteins that regulate progression through the G1-S phase of the cell cycle by binding to cyclin-dependent kinase (cdk)-4 to phosphorylate the retinoblastoma protein and release E2F transcription factors for progression through cell cycle. Several cancers, including breast, colon, and prostate, overexpress the cyclin D1 gene. However, the correlation of cyclin D1 overexpression with E2F target gene regulation or of cdk-dependent cyclin D1 activity with tumor development has not been identified. This suggests that the role of cyclin D1 in oncogenesis may be independent of its function as a cell cycle regulator. One such function is the role of cyclin D1 in cell adhesion and motility. Filamin A (FLNa), a member of the actin-binding filamin protein family, regulates signaling events involved in cell motility and invasion. FLNa has also been associated with a variety of cancers including lung cancer, prostate cancer, melanoma, human bladder cancer, and neuroblastoma. We hypothesized that elevated cyclin D1 facilitates motility in the invasive MDA-MB-231 breast cancer cell line. We show that MDA-MB-231 motility is affected by disturbing cyclin D1 levels or cyclin D1-cdk4/6 kinase activity. -
Gene Symbol Gene Description ACVR1B Activin a Receptor, Type IB
Table S1. Kinase clones included in human kinase cDNA library for yeast two-hybrid screening Gene Symbol Gene Description ACVR1B activin A receptor, type IB ADCK2 aarF domain containing kinase 2 ADCK4 aarF domain containing kinase 4 AGK multiple substrate lipid kinase;MULK AK1 adenylate kinase 1 AK3 adenylate kinase 3 like 1 AK3L1 adenylate kinase 3 ALDH18A1 aldehyde dehydrogenase 18 family, member A1;ALDH18A1 ALK anaplastic lymphoma kinase (Ki-1) ALPK1 alpha-kinase 1 ALPK2 alpha-kinase 2 AMHR2 anti-Mullerian hormone receptor, type II ARAF v-raf murine sarcoma 3611 viral oncogene homolog 1 ARSG arylsulfatase G;ARSG AURKB aurora kinase B AURKC aurora kinase C BCKDK branched chain alpha-ketoacid dehydrogenase kinase BMPR1A bone morphogenetic protein receptor, type IA BMPR2 bone morphogenetic protein receptor, type II (serine/threonine kinase) BRAF v-raf murine sarcoma viral oncogene homolog B1 BRD3 bromodomain containing 3 BRD4 bromodomain containing 4 BTK Bruton agammaglobulinemia tyrosine kinase BUB1 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) BUB1B BUB1 budding uninhibited by benzimidazoles 1 homolog beta (yeast) C9orf98 chromosome 9 open reading frame 98;C9orf98 CABC1 chaperone, ABC1 activity of bc1 complex like (S. pombe) CALM1 calmodulin 1 (phosphorylase kinase, delta) CALM2 calmodulin 2 (phosphorylase kinase, delta) CALM3 calmodulin 3 (phosphorylase kinase, delta) CAMK1 calcium/calmodulin-dependent protein kinase I CAMK2A calcium/calmodulin-dependent protein kinase (CaM kinase) II alpha CAMK2B calcium/calmodulin-dependent -
Hypoxia-Induced P53 Modulates Both Apoptosis and Radiosensitivity Via AKT
Hypoxia-induced p53 modulates both apoptosis and radiosensitivity via AKT Katarzyna B. Leszczynska, … , Francesca M. Buffa, Ester M. Hammond J Clin Invest. 2015;125(6):2385-2398. https://doi.org/10.1172/JCI80402. Research Article Oncology Restoration of hypoxia-induced apoptosis in tumors harboring p53 mutations has been proposed as a potential therapeutic strategy; however, the transcriptional targets that mediate hypoxia-induced p53-dependent apoptosis remain elusive. Here, we demonstrated that hypoxia-induced p53-dependent apoptosis is reliant on the DNA-binding and transactivation domains of p53 but not on the acetylation sites K120 and K164, which, in contrast, are essential for DNA damage–induced, p53-dependent apoptosis. Evaluation of hypoxia-induced transcripts in multiple cell lines identified a group of genes that are hypoxia-inducible proapoptotic targets of p53, including inositol polyphosphate-5-phosphatase (INPP5D), pleckstrin domain–containing A3 (PHLDA3), sulfatase 2 (SULF2), B cell translocation gene 2 (BTG2), cytoplasmic FMR1-interacting protein 2 (CYFIP2), and KN motif and ankyrin repeat domains 3 (KANK3). These targets were also regulated by p53 in human cancers, including breast, brain, colorectal, kidney, bladder, and melanoma cancers. Downregulation of these hypoxia-inducible targets associated with poor prognosis, suggesting that hypoxia-induced apoptosis contributes to p53-mediated tumor suppression and treatment response. Induction of p53 targets, PHLDA3, and a specific INPP5D transcript mediated apoptosis in response to hypoxia through AKT inhibition. Moreover, pharmacological inhibition of AKT led to apoptosis in the hypoxic regions of p53-deficient tumors and consequently increased radiosensitivity. Together, these results identify mediators of hypoxia-induced p53-dependent apoptosis and suggest AKT inhibition may improve radiotherapy response in p53-deficient tumors. -
Supplementary Figures
Mena regulates the LINC complex to control actin–nuclear lamina associations, trans-nuclear membrane signalling and cancer gene expression Frederic Li Mow Chee!, Bruno Beernaert!, Alexander Loftus!, Yatendra Kumar", Billie G. C. Griffith!, Jimi C. Wills!, Ann P. Wheeler#, J. Douglas Armstrong$, Maddy Parsons%, Irene M. Leigh,(, Charlotte M. Proby&, Alex von Kriegsheim!, Wendy A. Bickmore", Margaret C. Frame,* & Adam Byron,* Supplementary Information Supplementary Figure 1 Supplementary Figure 2 Supplementary Figure 3 Supplementary Table 1 Supplementary Table 2 Supplementary Table 3 Supplementary Table 4 !Cancer Research UK Edinburgh Centre, Institute of Genetics and Cancer, University of Edinburgh, Edinburgh EH< =XR, UK. "MRC Human Genetics Unit, Institute of Genetics and Cancer, University of Edinburgh, Edinburgh EH< =XU, UK. #Advanced Imaging Resource, Institute of Genetics and Cancer, University of Edinburgh, Edinburgh EH< =XU, UK. $Simons Initiative for the Developing Brain, School of Informatics, University of Edinburgh, Edinburgh EHH IYL, UK. %Randall Centre for Cell and Molecular Biophysics, King’s College London, London SEM MUL, UK. &Division of Molecular and Clinical Medicine, School of Medicine, University of Dundee, Dundee DD <HN, UK. 'Institute of Dentistry, Barts and the London School of Medicine and Dentistry, Queen Mary University of London, London EM =AT, UK. *email: [email protected] or [email protected] 1 a cSCC IAC correlation b cSCC IAC pathways c Core adhesome network ENAH −log10(q) MACF1 CSRP1 Met1 Met4 0 5 10 + + CORO2A Integrin signalling + CFL1 pathway PRNP ILK + HSPB1 PALLD PPFIA1 TES RDX Cytoskeletal regulation + VASP + + ARPC2 by Rho GTPase PPP2CA + Met1 + LASP1 MYH9 + VIM TUBA4A Huntington ITGA3 + disease ITGB4 VCL CAV1 ACTB ROCK1 KTN1 FLNA+ CALR DNA FBLIM1 CORO1B RAC1 + replication +ACTN1 ITGA6 + Met4 ITGAV Parkinson ITGB1 disease Actin cytoskel. -
Molecular Profile of Tumor-Specific CD8+ T Cell Hypofunction in a Transplantable Murine Cancer Model
Downloaded from http://www.jimmunol.org/ by guest on September 25, 2021 T + is online at: average * The Journal of Immunology , 34 of which you can access for free at: 2016; 197:1477-1488; Prepublished online 1 July from submission to initial decision 4 weeks from acceptance to publication 2016; doi: 10.4049/jimmunol.1600589 http://www.jimmunol.org/content/197/4/1477 Molecular Profile of Tumor-Specific CD8 Cell Hypofunction in a Transplantable Murine Cancer Model Katherine A. Waugh, Sonia M. Leach, Brandon L. Moore, Tullia C. Bruno, Jonathan D. Buhrman and Jill E. Slansky J Immunol cites 95 articles Submit online. Every submission reviewed by practicing scientists ? is published twice each month by Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts http://jimmunol.org/subscription Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html http://www.jimmunol.org/content/suppl/2016/07/01/jimmunol.160058 9.DCSupplemental This article http://www.jimmunol.org/content/197/4/1477.full#ref-list-1 Information about subscribing to The JI No Triage! Fast Publication! Rapid Reviews! 30 days* Why • • • Material References Permissions Email Alerts Subscription Supplementary The Journal of Immunology The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2016 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. This information is current as of September 25, 2021. The Journal of Immunology Molecular Profile of Tumor-Specific CD8+ T Cell Hypofunction in a Transplantable Murine Cancer Model Katherine A. -
Novel Association of Hypertrophic Cardiomyopathy, Sensorineural Deafness, and a Mutation in Unconventional Myosin VI (MYO6)
309 LETTER TO JMG J Med Genet: first published as 10.1136/jmg.2003.011973 on 1 April 2004. Downloaded from Novel association of hypertrophic cardiomyopathy, sensorineural deafness, and a mutation in unconventional myosin VI (MYO6) S A Mohiddin, Z M Ahmed, A J Griffith, D Tripodi, T B Friedman, L Fananapazir, R J Morell ............................................................................................................................... J Med Genet 2004;41:309–314. doi: 10.1136/jmg.2003.011973 amilial hypertrophic cardiomyopathy (FHC) is typically Key points characterised by left ventricular hypertrophy, diastolic Fdysfunction, and hypercontractility, and is often asso- ciated with disabling symptoms, arrhythmias, and sudden N Familial hypertrophic cardiomyopathy (FHC) is typi- death.1 FHC shows both non-allelic and allelic genetic cally confined to a cardiac phenotype and is caused by heterogeneity, and results from any one of more than 100 mutations in genes encoding sarcomeric proteins. mutations in genes encoding sarcomeric proteins.2 Identified Occasionally FHC may be one component of a genes include those encoding b myosin heavy chain, the hereditary multisystem disorder. myosin regulatory and essential light chains, myosin bind- N Sensorineural hearing loss is genetically heteroge- ing protein C, troponin I, troponin C, a cardiac actin, and neous. Mutations in the MYO6 gene, encoding 23 titin. The FHC phenotype is characterised by hypertrophy, unconventional myosin VI, have been found to cause myocyte disarray and fibrosis, and results from the dominant non-syndromic sensorineural hearing loss—that is, negative expression of one of these (mainly missense) sensorineural hearing loss in the absence of any other mutations. The resulting sarcomeric dysfunction leads related clinical features. ultimately, through mechanisms that remain obscure, to pathological left ventricular remodelling. -
Β-Catenin Confers Resistance to PI3K and AKT Inhibitors and Subverts Foxo3a to Promote Metastasis in Colon Cancer
β-catenin Confers Resistance to PI3K and AKT inhibitors and Subverts FOXO3a to Promote Metastasis in Colon Cancer Stephan P. Tenbaum1§, Paloma Ordóñez-Morán2§#, Isabel Puig1§, Irene Chicote1, Oriol Arqués1, Stefania Landolfi3, Yolanda Fernández4, José Raúl Herance5, Juan D. Gispert5, Leire Mendizabal6, Susana Aguilar7, Santiago Ramón y Cajal3, Simó Schwartz Jr4, Ana Vivancos6, Eloy Espín8, Santiago Rojas5, José Baselga9, Josep Tabernero10, Alberto Muñoz2, Héctor G. Palmer1* 1 Vall d’Hebrón Institut d´Oncología (VHIO). Stem Cells and Cancer Laboratory. Barcelona, Spain. 2 Instituto de Investigaciones Biomédicas "Alberto Sols", Consejo Superior de Investigaciones Científicas-Universidad Autónoma de Madrid, Madrid, Spain. 3 Department of Pathology, Hospital Universitari Vall d'Hebrón, Universitat Autònoma de Barcelona, Barcelona, Spain. 4 Group of Drug Delivery and Targeting, CIBBIM-Nanomedicine and Networking Biomedical Research Center on Bioengineering, Biomaterials and Nanomedicine (CIBER-BBN), Hospital Universitari Vall d’Hebrón, Institut de Recerca Vall d’Hebrón, Universitat Autònoma de Barcelona, Barcelona, Spain. 5 Parc de Recerca Biomèdica de Barcelona (PRBB), Centre d´Imatge Molecular (CRC) Corporació Sanitària, Barcelona, Spain. 6 Vall d’Hebrón Institut d´Oncología (VHIO). Genomics Cancer Group. Barcelona, Spain. 7 Centre for Respiratory Research, Rayne Institute, University College London, London, United Kingdom, Hematopoietic Stem Cell Laboratory, London Research Institute, Cancer Research UK, London, United Kingdom. 8 General Surgery Service, Hospital Universitari Vall d'Hebrón, Barcelona, Spain. 9 Massachusetts General Hospital Cancer Center, Harvard Medical School, Charlestown, USA; Howard Hughes Medical Institute, Chevy Chase, USA. 10 Medical Oncology Department, Hospital Universitari Vall d'Hebrón, Barcelona, Spain. # Swiss Institute for Experimental Cancer Research, École Polytechnique Fédérale de Lausanne, Lausanne, Switzerland. -
Datasheet A02938-1 Anti-LGALS3BP Antibody
Product datasheet Anti-LGALS3BP Antibody Catalog Number: A02938-1 BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected] Basic Information Product Name Anti-LGALS3BP Antibody Gene Name LGALS3BP Source Rabbit IgG Species Reactivity human,mouse Tested Application WB,IHC-P Contents 500ug/ml antibody with PBS ,0.02% NaN3 , 1mg BSA and 50% glycerol. Immunogen A synthetic peptide corresponding to a sequence of human LGALS3BP (HEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPR). Purification Immunogen affinity purified. Observed MW 65KD Dilution Ratios Western blot: 1:500-2000 Immunohistochemistry in paraffin section: 1:50-400 (Boiling the paraffin sections in 10mM citrate buffer,pH6.0,or PH8.0 EDTA repair liquid for 20 mins is required for the staining of formalin/paraffin sections.) Optimal working dilutions must be determined by end user. Storage 12 months from date of receipt,-20℃ as supplied.6 months 2 to 8℃ after reconstitution. Avoid repeated freezing and thawing Background Information Galectin-3-binding protein is a protein that in humans is encoded by the LGALS3BP gene. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Using fluorescence in situ hybridization the full length 90K cDNA has been localized to chromosome 17q25. -
Pancreatic Cancer Invasion of the Lymphatic Vasculature and Contributions of the Tumor Microenvironment: Roles for E- Selectin and CXCR4
University of Nebraska Medical Center DigitalCommons@UNMC Theses & Dissertations Graduate Studies Fall 12-16-2016 Pancreatic Cancer Invasion of the Lymphatic Vasculature and Contributions of the Tumor Microenvironment: Roles for E- selectin and CXCR4 Maria M. Steele University of Nebraska Medical Center Follow this and additional works at: https://digitalcommons.unmc.edu/etd Recommended Citation Steele, Maria M., "Pancreatic Cancer Invasion of the Lymphatic Vasculature and Contributions of the Tumor Microenvironment: Roles for E-selectin and CXCR4" (2016). Theses & Dissertations. 166. https://digitalcommons.unmc.edu/etd/166 This Dissertation is brought to you for free and open access by the Graduate Studies at DigitalCommons@UNMC. It has been accepted for inclusion in Theses & Dissertations by an authorized administrator of DigitalCommons@UNMC. For more information, please contact [email protected]. i PANCREATIC CANCER INVASION OF THE LYMPHATIC VASCULATURE AND CONTRIBUTIONS OF THE TUMOR MICROENVIRONMENT: ROLES FOR E-SELECTIN AND CXCR4 By Maria M. Steele A DISSERTATION Presented to the Faculty of the University of Nebraska Graduate College in Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy Cancer Research Graduate Program Under the Supervision of Professor Michael A. Hollingsworth University of Nebraska Medical Center Omaha, NE November, 2016 Supervisory Committee Michael A. Hollingsworth, Ph.D. Kaustubh Datta, Ph.D. Angie Rizzino, Ph.D. Joyce C. Solheim, Ph.D. ii PANCREATIC CANCER INVASION OF THE LYMPHATIC VASCULATURE AND CONTRIBUTIONS OF THE TUMOR MICROENVIRONMENT: ROLES FOR E-SELECTIN AND CXCR4 Maria M. Steele University of Nebraska, 2016 Advisor: Michael A. Hollingsworth ABSTRACT As the fourth leading cause of cancer-related deaths, pancreatic cancer is one of the most lethal forms of cancers in the United States. -
The Role of the S6K2 Splice Isoform in Mtor/S6K Signalling and Cellular Functions
The role of the S6K2 splice isoform in mTOR/S6K signalling and cellular functions Olena Myronova A thesis submitted to the University College London in fulfilment with the requirements for the degree of Doctor of Philosophy London, November 2015 Research Department of Structural and Molecular Biology Division of Biosciences University College London Gower Street London, WC1E 6BT United Kingdom Ludwig Institute for Cancer Research 666 Third Avenue, 28th floor New York, N.Y. 10017 USA The role of the S6K2 splice isoform in mTOR/S6K signalling and cellular functions 1 Declaration I, Olena Myronova, declare that all the work presented in this thesis is the result of my own work. The work presented here does not constitute part of any other thesis. Where information has been derived from other sources, I confirm that this has been indicated in the thesis. The work here in was carried out while I was a graduate research student at University College London, Research Department of Structural and Molecular Biology under the supervision of Professor Ivan Gout. Olena Myronova The role of the S6K2 splice isoform in mTOR/S6K signalling and cellular functions 2 Abstract Ribosomal S6 kinase (S6K) is a member of the AGC family of serine/threonine protein kinases and plays a key role in diverse cellular processes, including cell growth, survival and metabolism. Activation of S6K by growth factors, amino acids, energy levels and hypoxia is mediated by the mTOR and PI3K signalling pathways. Dysregulation of S6K activity has been implicated in a number of human pathologies, including cancer, diabetes, obesity and ageing. -
Circular RNA Hsa Circ 0005114‑Mir‑142‑3P/Mir‑590‑5P‑ Adenomatous
ONCOLOGY LETTERS 21: 58, 2021 Circular RNA hsa_circ_0005114‑miR‑142‑3p/miR‑590‑5p‑ adenomatous polyposis coli protein axis as a potential target for treatment of glioma BO WEI1*, LE WANG2* and JINGWEI ZHAO1 1Department of Neurosurgery, China‑Japan Union Hospital of Jilin University, Changchun, Jilin 130033; 2Department of Ophthalmology, The First Hospital of Jilin University, Jilin University, Changchun, Jilin 130021, P.R. China Received September 12, 2019; Accepted October 22, 2020 DOI: 10.3892/ol.2020.12320 Abstract. Glioma is the most common type of brain tumor APC expression with a good overall survival rate. UALCAN and is associated with a high mortality rate. Despite recent analysis using TCGA data of glioblastoma multiforme and the advances in treatment options, the overall prognosis in patients GSE25632 and GSE103229 microarray datasets showed that with glioma remains poor. Studies have suggested that circular hsa‑miR‑142‑3p/hsa‑miR‑590‑5p was upregulated and APC (circ)RNAs serve important roles in the development and was downregulated. Thus, hsa‑miR‑142‑3p/hsa‑miR‑590‑5p‑ progression of glioma and may have potential as therapeutic APC‑related circ/ceRNA axes may be important in glioma, targets. However, the expression profiles of circRNAs and their and hsa_circ_0005114 interacted with both of these miRNAs. functions in glioma have rarely been studied. The present study Functional analysis showed that hsa_circ_0005114 was aimed to screen differentially expressed circRNAs (DECs) involved in insulin secretion, while APC was associated with between glioma and normal brain tissues using sequencing the Wnt signaling pathway. In conclusion, hsa_circ_0005114‑ data collected from the Gene Expression Omnibus database miR‑142‑3p/miR‑590‑5p‑APC ceRNA axes may be potential (GSE86202 and GSE92322 datasets) and explain their mecha‑ targets for the treatment of glioma.