Pinin (PNN) Rabbit Polyclonal Antibody – TA337687 | Origene
Total Page:16
File Type:pdf, Size:1020Kb
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA337687 Pinin (PNN) Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-PNN antibody: synthetic peptide directed towards the N terminal of human PNN. Synthetic peptide located within the following region: MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGP Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Affinity Purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 81 kDa Gene Name: pinin, desmosome associated protein Database Link: NP_002678 Entrez Gene 5411 Human Q9H307 Background: PNN is the transcriptional activator binding to the E-box 1 core sequence of the E-cadherin promoter gene; the core-binding sequence is 5'CAGGTG-3'. PNN is capable of reversing CTBP1-mediated transcription repression. Component of a splicing-dependent mul Synonyms: DRS; DRSP; memA; SDK3 Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 Pinin (PNN) Rabbit Polyclonal Antibody – TA337687 Protein Families: Stem cell - Pluripotency, Transcription Factors Product images: WB Suggested Anti-PNN Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: HepG2 cell lysate.PNN is strongly supported by BioGPS gene expression data to be expressed in HepG2 Host: Rabbit; Target Name: PNN; Sample Tissue: Hela; Antibody Dilution: 1.0ug/ml; PNN is strongly supported by BioGPS gene expression data to be expressed in HeLa This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 Pinin (PNN) Rabbit Polyclonal Antibody – TA337687 Host: Rabbit; Target Name: PNN; Sample Tissue: 721_B; Antibody Dilution: 1.0ug/ml; PNN is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.