DOCSLIB.ORG

Www .Alfa.Com

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Www .Alfa.Com Bio 2013-14 Alfa Aesar North America Alfa Aesar Korea Uni-Onward (International Sales Headquarters) 101-3701, Lotte Castle President 3F-2 93 Wenhau 1st Rd, Sec 1, 26 Parkridge Road O-Dong Linkou Shiang 244, Taipei County Ward Hill, MA 01835 USA 467, Gongduk-Dong, Mapo-Gu Taiwan Tel: 1-800-343-0660 or 1-978-521-6300 Seoul, 121-805, Korea Tel: 886-2-2600-0611 Fax: 1-978-521-6350 Tel: +82-2-3140-6000 Fax: 886-2-2600-0654 Email: [email protected] Fax: +82-2-3140-6002 Email: [email protected] Email: [email protected] Alfa Aesar United Kingdom Echo Chemical Co. Ltd Shore Road Alfa Aesar India 16, Gongyeh Rd, Lu-Chu Li Port of Heysham Industrial Park (Johnson Matthey Chemicals India Toufen, 351, Miaoli Heysham LA3 2XY Pvt. Ltd.) Taiwan England Kandlakoya Village Tel: 866-37-629988 Bio Chemicals for Life Tel: 0800-801812 or +44 (0)1524 850506 Medchal Mandal Email: [email protected] www.alfa.com Fax: +44 (0)1524 850608 R R District Email: [email protected] Hyderabad - 501401 Andhra Pradesh, India Including: Alfa Aesar Germany Tel: +91 40 6730 1234 Postbox 11 07 65 Fax: +91 40 6730 1230 Amino Acids and Derivatives 76057 Karlsruhe Email: [email protected] Buffers Germany Tel: 800 4566 4566 or Distributed By: Click Chemistry Reagents +49 (0)721 84007 280 Electrophoresis Reagents Fax: +49 (0)721 84007 300 Hydrus Chemical Inc. Email: [email protected] Uchikanda 3-Chome, Chiyoda-Ku Signal Transduction Reagents Tokyo 101-0047 Western Blot and ELISA Reagents Alfa Aesar France Japan 2 allée d’Oslo Tel: 03(3258)5031 ...and much more 67300 Schiltigheim Fax: 03(3258)6535 France Email: [email protected] Tel: 0800 03 51 47 or +33 (0)3 8862 2690 Fax: 0800 10 20 67 or OOO “REAKOR” +33 (0)3 8862 6864 Nagorny Proezd, 7 Email: [email protected] 117 105 Moscow Russia Alfa Aesar China Tel: +7 495 640 3427 Room 1509 Fax: +7 495 640 3427 ext 6 CBD International Building Email: [email protected] No. 16 Yong’An Dong Li Chao Yang District, Beijing, China VWR Singapore Pte Ltd 100022 18 Gul Drive Tel: 800-810-6000 or 86 (010)-8567-8600 Singapore 629468 or 400 610 6006 Tel: +65 6505 0760 Bulk Sales: 800 810 6006 Fax: +65 6264 3780 Fax: 86 (010)-8567-8601 Email: [email protected] Email: [email protected] Introducing Alfa Aesar Bio Access the Latest Information www.alfa.com Alfa Aesar is pleased to introduce the Looking for new Our website provides easy latest addition to its complete range products? access to the following: of over 46,000 products. • Material Safety Data Sheets Want to check (MSDS) The new biochemical product range product availability? • Certificates of Analysis • Up-to-date product availability adds over 4,000 products to the • Current pricing and ability to existing offering, providing a more Need more information? request pricing quotations complete selection for all of your • Structure/substructure search research needs. Visit Other enhancements to the With a wide and continuously growing www.alfa.com site include: variety of materials for biological • Improved search function research including electrophoresis • Easy online shopping reagents, enzymes, signal transduction • Order tracking and history • Complete technical reagents and much more, Alfa Aesar information and literature now truly offers one stop chemical references shopping combined with unparalleled customer service. Visit www.alfa.com for the latest news and product availability Table of Contents Table of Contents _________________________________________________________________________________I Key to Chemical Listings _________________________________________________________________________ II How to Order ____________________________________________________________________________________III General Information _____________________________________________________________________________IV Terms of Sale ____________________________________________________________________________________V Product Information _____________________________________________________________________________VI Product Safety - MSDS ___________________________________________________________________________VIII Bulk and Specialty Capabilities __________________________________________________________________IX Alfa Aesar Product Lines ________________________________________________________________________ X Periodic Table _________________________________________________________________________________ XII Abbreviations and Codes ________________________________________________________________________ 1 PRODUCT CATEGORY INDEX _________________________________________________________ 3 ACS Reagents ___________________________________________________________________________________ 3 Amino Acids and Derivatives _____________________________________________________________________ 5 Antibiotics ______________________________________________________________________________________ 9 Antibodies ____________________________________________________________________________________ 11 Apoptosis Reagents ____________________________________________________________________________ 12 Buffers _________________________________________________________________________________________ 14 Carbohydrates and Derivatives _________________________________________________________________ 23 Cell Culture Reagents ___________________________________________________________________________ 25 Chiral Compounds _____________________________________________________________________________ 27 Click Chemistry Reagents ______________________________________________________________________ 29 Electrophoresis Reagents _______________________________________________________________________ 30 Enzymes _______________________________________________________________________________________ 38 Growth Factors _________________________________________________________________________________ 40 Natural Products _______________________________________________________________________________ 41 Nucleosides and Nucleotides __________________________________________________________________ 43 Peptides________________________________________________________________________________________ 47 Signal Transduction Reagents ___________________________________________________________________ 51 Solvents, Acids and Bases _______________________________________________________________________ 62 Stains, Dyes and Indicators ____________________________________________________________________ 63 Vitamins _______________________________________________________________________________________ 66 Western Blot and ELISA Reagents ________________________________________________________________ 67 ALPHABETICAL CHEMICAL LISTING _________________________________________ 69 I www.alfa.com Bio Intro_GL.indd 1 8/13/2012 9:46:09 AM Key to Chemical Listings 1 2 7 4 J62011 A-7 hydrochloride 25mg [N-(10-Aminodecyl)-5-chloro-1-naphthalenesulfonamide hydrochloride] [79127-24-5], C20H29ClN2O2SùHCl, F.W. 433.44, Solid H:H315-H319-H335, P:P261-P305+P351+P338-P302+P352-P321-P405-P501a 12 Application(s):Calmodulin antagonist J60039 Abamectin, 97+% 1g 5 [Avermectin B1] 5g [71751-41-2], C48H72O14, F.W. 873.10, Powder,m.p. 150-155ø,Merck 14,2,UN2811, 9 MDL MFCD01769550 25g H:H300-H400-H332, P:P261-P301+P310-P321-P304+P340-P405-P501a8 Application(s): Interacts with GABA receptorsto cause chloride channel14 activation L137706 Abieticacid, tech.75% È 3 25g [514-10-3], C20H30O2, F.W. 302.45, Merck 14,7, EINECS 208-178-3, 100g BRN 2221451, MDL MFCD03423567, Ì 11 10 H:H315-H319-H335, P:P261-P305+P351+P338-P302+P352-P321-P405-P501a 13 1 Stock number 9 UN Dangerous Goods number 2 Product name and grade 10 Denotes substance is listed in Toxic Substance Control Act (TSCA) Sensitivity symbol inventory 3 (see abbreviations index) 11 Globally Harmonized System (GHS) 4 Unit size Pictograms 5 Alternative name(s) 12 Precautionary and Hazard Codes 6 Chemical Abstract Service 13 Chemical structure (CAS) number 14 EINECS (European Inventory of Existing 7 Molecular formula Chemical Substances) Number 8 Physical form F.W. Formula weight Merck Merck Index Number m.p. Melting point BRN Beilstein Registry number b.p. Boiling point Fieser Fieser’s Reagents reference f.p. Flash point RTECS Registry of Toxic Effects of d. Density in g/ml Chemical Substances reference Ë Refractive index MDL MDL number ¾ Optical rotation II Bio Intro_GL.indd 2 8/13/2012 9:46:10 AM How to Order TELEPHONE EMAIL Please have the following information [email protected] available when placing an order: for catalogue product orders and general inquiries Your customer number (if applicable). Billing and shipping addresses. [email protected] for technical inquiries Product stock number, size, and quantity for each item you wish to [email protected] order. for bulk and specialty inquiries Your purchase order number or We do not require a confirming purchase government/corporate credit card order. If you choose to send one, please number and expiration date. mark it clearly, “CONFIRMING ORDER” to avoid possible duplication. There is no INTERNET minimum order. We welcome all orders, www.alfa.com regardless of size. Our web catalogue features up-to-date prices and a user-friendly e-commerce Alfa Aesar is ISO 9001 and ISO 14001 system. Certified III www.alfa.com Bio Intro_GL.indd 3 8/13/2012 9:46:11 AM General Information ORDERING Customer Service Representatives are available weekdays to assist you. When you call to place an order, we will work with you to learn your specific needs. There is no minimum order.
Load more

Recommended publications
  • Pest Management Strategic Plan for Strawberry Production in California
    PEST MANAGEMENT STRATEGIC PLAN FOR STRAWBERRY PRODUCTION IN CALIFORNIA 1 | Page TABLE OF CONTENTS INTRODUCTION ................................................................................................................................................... 5 Previous Pest Management Strategic Plan .............................................................................................. 5 Development of the New Plan .................................................................................................................... 5 STRAWBERRY MARKET SHARE AND VALUE.................................................................................................... 10 STRAWBERRY PRODUCTION OVERVIEW ........................................................................................................ 13 PEST MANAGEMENT FOR COMMERCIAL STRAWBERRY PLANTINGS ......................................................... 22 LAND PREPARATON THROUGH PLANTING ............................................................................................... 22 Activities Prior to Fumigation................................................................................................................. 22 Soil Fumigation ........................................................................................................................................ 22 Planting ..................................................................................................................................................... 25 Work Group Recommendations for
    [Show full text]
  • Proteinase K Dna Extraction Protocol
    FT-85870n Proteinase K Product data Proteinase K, from Tritirachium album timber (Engyodontium album) Syn.: peptidase K, Tritirachium alkaline proteinase Protein K powder #858706 Proteinase K solution #718961 CAS: [ 39450-01-6 ] MW: 8,900 daltons (28.9 kDa). primary sequence for proteinase K: GAAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEF EGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDN GSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQ SSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVL DIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASAC Proteinase K Protein Structure RYIADTANKGDLSNIPFGTVNLLAYNNYQA FAQ & Technical tips What is Proteinase K? PProteinase K (also protease K or endopeptidase K) is a broad-spectrum serine protease widely used in molecular biology. Proteinase K is able to digest native keratin (hair), hence, the name “Proteinase K”. It is commonly used because of its broad specificity, that makes it useful to clean nucleic acid complexe samples and to lyse cells. It has been used for isolation of mRNA, high molecular weight DNA and to inactivate other enzymatic activities. The enzyme was discovered in 1974 in extracts of the fungus Engyodontium album (formerly Tritirachium album). What are proteinase K applications? Proteinase K is ideal for many molecular biology applications because it is able to break down proteins and inactivate DNases and RNases that would otherwise degrade a desired sample of DNA or RNA. - Digestion of unwanted proteins in molecular biology applications - Removal of endotoxins bound to cationic proteins such as lysozyme and RNaseA - Removal of nucleases for in situ hybridization - Prion research with respect to TSE (transmissible spongiform encephalopathies) - Protease footprinting - Mitochontrial isolation - Isolation of genomic DNA - Isolation of cytoplasmic RNA - Isolation of highly native DNA or RNA Proteinase K is commonly used in molecular biology to digest protein and remove contamination from preparations of nucleic acid.
    [Show full text]
  • Proteinase K # GE010.0100 – 100 Mg (FOR RESEARCH ONLY)
    Product Info GE010 1 V6.0 – 6/2020 Proteinase K # GE010.0100 – 100 mg (FOR RESEARCH ONLY) Proteinase K is a broad-spectrum serine protease (28.9kDa monomer) that cleaves peptide bonds at the carboxylic sides of aliphatic, aromatic, and hydrophobic amino acids. Quantity 100 mg lyophilized powder purified from Pichia pastoris harbouring the gene encoding endolytic protease from Tritirachium album. Supplied with 1 ml of a 10x concentrated Storage Buffer. Applications Isolation of genomic DNA from cultured cells and tissues; removal of DNases and RNases during DNA and/or RNA purification; determination of enzyme locations. Specifications Free of DNases and RNases. Specific Activity: >30 units per mg. Quality Control Enzyme activity is assayed by digesting hemoglobin at a concentration of 16.7 mg/ml in a solution of 80mM potassium phosphate (pH 7.5), 5M urea, 4mM NaCl, 3mM CaCl2. Absence of endodeoxyribonucleases, exodeoxyribonucleases, and ribonucleases was confirmed by appropriate assays. Storage Store lyophilized powder at +4ºC for several months or -20ºC for at least 2 years. The concentrated (10x) storage buffer (500mM Tris-HCl, 50mM CaCl2) can be stored at room temperature or +4ºC. GRiSP Research Solutions 2020 Product Info GE010 2 V6.0 – 6/2020 Prior to use Reconstitute Proteinase K at a desired concentration (e.g. 10 mg/ml) using either ultrapure water or 1x Storage Buffer (50mM Tris-HCl pH8.0) [dilute storage buffer with ultrapure DNase/RNase-free water with or without glycerol (see below)]. Reconstituted Proteinase K should be stored at +4ºC for up to a few months. If longer storage is required, reconstitute Proteinase K in 1x Storage Buffer containing 50% glycerol and store at -20ºC Enzyme activity Proteinase K is activated by calcium (1-5mM).
    [Show full text]
  • Effect of Aminophylline on Diaphragmatic Contractility in the Piglet
    003 1-3998/90/2803-0196$02.00/0 PEDIATRIC RESEARCH Vol. 28, No. 3, 1990 Copyright 0 1990 International Pediatric Research Foundation, Inc. Printed in (I.S.A. Effect of Aminophylline on Diaphragmatic Contractility in the Piglet DENNIS E. MAYOCK, THOMAS A. STANDAERT, JON F. WATCHKO, AND DAVID E. WOODRUM1 University of Washington School of Medicine, Department of Pediatrics, Division of Neonatal and Respiratory Diseases, Seattle, Washington 98195 ABSTRACT. Minute ventilation, arterial blood gases, ar- of arterial oxygen > 8 kPa (60 torr) in room air, and a partial terial pH, cardiac output, and transdiaphragmatic force pressure of the arterial carbon dioxide 5 6.7 kPa (50 torr) were generation, both during spontaneous ventilation and in accepted for study. The animals were anesthetized with an i.v. response to phrenic nerve stiwulation during airway occlu- combination of chloralose (30 mg/kg) and urethane (1 50 mg/ sion at end expiration, were measured in nine anesthetized, kg) and studied in the supine position. Subsequent infusions of tracheostomized piglets before and 30 min after parenteral anesthetic were used if the piglet developed jaw clonus. A trache- infusion of 20 mg/kg aminophylline. Serum theophylline ostomy was placed and connected to a two-way nonrebreathing levels averaged 109 f 21 ~mol/L(19.7 f 3.7 ~g/mL)at valve (model 2384, Hans Rudolph, Inc., Kansas City, MO). 30 min postinfusion. No significant changes were noted in Inspiratory flow was detected by a hot-wire anemometer and pH, blood gases, blood Pressure, or ventilatory measures integrated to provide tidal volume. All animals breathed 50% after aminophylline.
    [Show full text]
  • Aminophylline Catalog Number A1755 Storage
    Aminophylline Catalog Number A1755 Storage Temperature –20 °C Replacement for Catalog Number 216895 CAS RN 317-34-0 Storage/Stability Synonyms: theophylline hemiethylenediamine complex; Aminophylline should be kept tightly closed to prevent 3,7-dihydro-1,3-demethyl-1H-purine-2,6-dione CO2 absorption from the atmosphere, which leads to compound with 1,2-ethanediamine (2:1); formation of theophylline and decreased solubility in 1,2 3 (theophylline)2 • ethylenediamine aqueous solutions. Stock solutions should be protected from light and prevented from contact with Product Description metals.2 Molecular Formula: C7H8N4O2 ·1/2 (C2H8N2) Molecular Weight: 210.3 References 1. The Merck Index, 12th ed., Entry# 485. Aminophylline is a xanthine derivative which is a 2. Martindale: The Extra Pharmacopoeia, 31st ed., combination of theophylline and ethylenediamine that is Reynolds, J. E. F., ed., Royal Pharmaceutical more water soluble than theophylline alone. Society (London, England: 1996), pp. 1651-1652. Aminophylline has been widely used as an inhibitor of 3. Data for Biochemical Research, 3rd ed., Dawson, cAMP phosphodiesterase.3 R. M. C., et al., Oxford University Press (New York, NY: 1986), pp. 316-317. Aminophylline has been shown to limit 4. Pelech, S. L., et al., cAMP analogues inhibit phosphatidylcholine biosynthesis in cultured rat phosphatidylcholine biosynthesis in cultured rat hepatocytes.4 It has been used in studies of acute hepatocytes. J. Biol. Chem., 256(16), 8283-8286 hypoxemia in newborn and older guinea pigs.5 The (1981). effect of various xanthine derivatives, including 5. Crisanti, K. C., and Fewell, J. E., Aminophylline aminophylline, on activation of the cystic fibrosis alters the core temperature response to acute transmembrane conductance regulator (CFTR) chloride hypoxemia in newborn and older guinea pigs.
    [Show full text]
  • NINDS Custom Collection II
    ACACETIN ACEBUTOLOL HYDROCHLORIDE ACECLIDINE HYDROCHLORIDE ACEMETACIN ACETAMINOPHEN ACETAMINOSALOL ACETANILIDE ACETARSOL ACETAZOLAMIDE ACETOHYDROXAMIC ACID ACETRIAZOIC ACID ACETYL TYROSINE ETHYL ESTER ACETYLCARNITINE ACETYLCHOLINE ACETYLCYSTEINE ACETYLGLUCOSAMINE ACETYLGLUTAMIC ACID ACETYL-L-LEUCINE ACETYLPHENYLALANINE ACETYLSEROTONIN ACETYLTRYPTOPHAN ACEXAMIC ACID ACIVICIN ACLACINOMYCIN A1 ACONITINE ACRIFLAVINIUM HYDROCHLORIDE ACRISORCIN ACTINONIN ACYCLOVIR ADENOSINE PHOSPHATE ADENOSINE ADRENALINE BITARTRATE AESCULIN AJMALINE AKLAVINE HYDROCHLORIDE ALANYL-dl-LEUCINE ALANYL-dl-PHENYLALANINE ALAPROCLATE ALBENDAZOLE ALBUTEROL ALEXIDINE HYDROCHLORIDE ALLANTOIN ALLOPURINOL ALMOTRIPTAN ALOIN ALPRENOLOL ALTRETAMINE ALVERINE CITRATE AMANTADINE HYDROCHLORIDE AMBROXOL HYDROCHLORIDE AMCINONIDE AMIKACIN SULFATE AMILORIDE HYDROCHLORIDE 3-AMINOBENZAMIDE gamma-AMINOBUTYRIC ACID AMINOCAPROIC ACID N- (2-AMINOETHYL)-4-CHLOROBENZAMIDE (RO-16-6491) AMINOGLUTETHIMIDE AMINOHIPPURIC ACID AMINOHYDROXYBUTYRIC ACID AMINOLEVULINIC ACID HYDROCHLORIDE AMINOPHENAZONE 3-AMINOPROPANESULPHONIC ACID AMINOPYRIDINE 9-AMINO-1,2,3,4-TETRAHYDROACRIDINE HYDROCHLORIDE AMINOTHIAZOLE AMIODARONE HYDROCHLORIDE AMIPRILOSE AMITRIPTYLINE HYDROCHLORIDE AMLODIPINE BESYLATE AMODIAQUINE DIHYDROCHLORIDE AMOXEPINE AMOXICILLIN AMPICILLIN SODIUM AMPROLIUM AMRINONE AMYGDALIN ANABASAMINE HYDROCHLORIDE ANABASINE HYDROCHLORIDE ANCITABINE HYDROCHLORIDE ANDROSTERONE SODIUM SULFATE ANIRACETAM ANISINDIONE ANISODAMINE ANISOMYCIN ANTAZOLINE PHOSPHATE ANTHRALIN ANTIMYCIN A (A1 shown) ANTIPYRINE APHYLLIC
    [Show full text]
  • Tanibirumab (CUI C3490677) Add to Cart
    5/17/2018 NCI Metathesaurus Contains Exact Match Begins With Name Code Property Relationship Source ALL Advanced Search NCIm Version: 201706 Version 2.8 (using LexEVS 6.5) Home | NCIt Hierarchy | Sources | Help Suggest changes to this concept Tanibirumab (CUI C3490677) Add to Cart Table of Contents Terms & Properties Synonym Details Relationships By Source Terms & Properties Concept Unique Identifier (CUI): C3490677 NCI Thesaurus Code: C102877 (see NCI Thesaurus info) Semantic Type: Immunologic Factor Semantic Type: Amino Acid, Peptide, or Protein Semantic Type: Pharmacologic Substance NCIt Definition: A fully human monoclonal antibody targeting the vascular endothelial growth factor receptor 2 (VEGFR2), with potential antiangiogenic activity. Upon administration, tanibirumab specifically binds to VEGFR2, thereby preventing the binding of its ligand VEGF. This may result in the inhibition of tumor angiogenesis and a decrease in tumor nutrient supply. VEGFR2 is a pro-angiogenic growth factor receptor tyrosine kinase expressed by endothelial cells, while VEGF is overexpressed in many tumors and is correlated to tumor progression. PDQ Definition: A fully human monoclonal antibody targeting the vascular endothelial growth factor receptor 2 (VEGFR2), with potential antiangiogenic activity. Upon administration, tanibirumab specifically binds to VEGFR2, thereby preventing the binding of its ligand VEGF. This may result in the inhibition of tumor angiogenesis and a decrease in tumor nutrient supply. VEGFR2 is a pro-angiogenic growth factor receptor
    [Show full text]
  • 7 EDTA, Tetraso
    REPORT Safety Assessment of EDTA, Calcium Disodium EDTA. Diammonium EDTA, Dipotassium EDTA. 7 Disodium EDTA, TEA- EDTA, Tetrasod=um EDTA, Tripotassium EDTA, Trisodium EDTA, HEDTA and Trisodium HEDTA ABSTRACT EDTA (ethylenediamine tetraacetic acid) and its salts are substituted diamines. HEDTA (hydroxyethyl ethylenediamine triacetic acid) and its trisodium salt are substituted amines. These ingredients function as chelating agents in cosmetic formulations. The typical concentration of use of EDTA is less than 2%, with the other salts in current use at even lower concentrations. The lowest dose reported to cause a toxic effect in animals was 750 mg/kg/day. These chelating agents are cytotoxic and weakly genotoxic, but not carcinogenic. Oral exposures to EDTA produced adverse reproductive and developmental effects in animals. Clinical tests reported no absorption of an EDTA salt through the skin. These ingredients, are likely, however, to affect the passage of other chemicals into the skin because they will chelate calcium. Exposure to ED TA in most cosmetic formulations, therefore, would produce systemic exposure levels well below those seen to be toxic in oral dosing studies. Exposure to EDTA in cosmetic formulations that may be inhaled, however, was a concern. An exposure assessment done using conservative assumptions predicted that the maximum EDTA dose via inhalation of an aerosolized cosmetic formulation is below that which has been shown to produce reproductive or developmental toxicity. Because of the potential to increase the penetration of other chemicals, formulators should continue to be aware of this when combining these ingredients with ingredients that previously have been determined to be safe primarily because they were not significanUy absorbed.
    [Show full text]
  • Lessons and Considerations for the Creation of Universal Primers Targeting Non-Conserved, Horizontally
    bioRxiv preprint doi: https://doi.org/10.1101/2020.03.30.017442; this version posted April 1, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. 1 Lessons and considerations for the creation of universal primers targeting non-conserved, horizontally 2 mobile genes 3 4 Damon C. Brown,a Raymond J. Turnera# 5 aDepartment of Biological Sciences, University of Calgary, Calgary, Alberta, Canada 6 7 Running Head: Primer design approaches for nonconserved mobile genes 8 #Address correspondence to Raymond J. Turner, [email protected] 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.03.30.017442; this version posted April 1, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. 9 Abstract 10 Effective and accurate primer design is an increasingly important skill as the use of PCR-based 11 diagnostics in clinical and environmental settings is on the rise. While universal primer sets have been 12 successfully designed for highly conserved core genes such as 16S rRNA and characteristic genes such as 13 dsrAB and dnaJ, primer sets for mobile, accessory genes such as multidrug resistance efflux pumps 14 (MDREP) have not been explored. Here, we describe an approach to create universal primer sets for 15 select MDREP genes chosen from five superfamilies (SMR, MFS, MATE, ABC and RND) identified in a 16 model community of six members (Acetobacterium woodii, Bacillus subtilis, Desulfovibrio vulgaris, 17 Geoalkalibacter subterraneus, Pseudomonas putida and Thauera aromatica).
    [Show full text]
  • S-Carboxymethylcysteine Synthase from Escherichia Coli
    Agric. Biol. Chem., 53 (9), 2481 -2487, 1989 2481 S-Carboxymethylcysteine Synthase from Escherichia coli Hidehiko Kumagai,* Hideyuki Suzuki, Hiroki Shigematsu and Tatsurokuro Tochikura Department of Food Science and Technology, Faculty of Agriculture, Kyoto University, Kyoto 606, Japan Received April 14, 1989 An enzyme that catalyzes the synthesis of S-carboxymethyl-L-cysteine from 3-chloro-L-alanine (3-Cl-Ala) and thioglycolic acid was found in Escherichia coli W3110 and was designated as S- carboxymethyl-L-cysteine synthase. It was purified from the cell-free extract to electrophoretic homogeneity and was crystallized. The enzymehas a molecular weight of 84,000 and gave one band corresponding to a molecular weight of 37,000 on SDS-polyacrylamide gel electrophoresis. The purified enzyme catalyzed the ^-replacement reactions between 3-Cl-Ala and various thiol compounds. The apparent Kmvalues for 3-Cl-Ala and thioglycolic acid were 40mMand 15.4mM.The enzyme showedvery low activity as to the a,/^-elimination reaction with 3-Cl-Ala and L-serine. It was not inactivated on the incubation with 3-Cl-Ala. Theabsorption spectrum of the enzymeshows a maximum at 412nm, indicating that it contains pyridoxal phosphate as a co factor. The N-terminal amino acid sequence was determined and the corresponding sequence was detected in the protein sequence data bank, but no homogeneous sequence was found. 3-Chloro-L-alanine (3-Cl-Ala) acts as a so- called suicide substrate for some pyridoxal- Materials and Methods phosphate (PLP) dependent enzymes, such Reagents. Casamino acids and Tryptone were obtained as glutamate-oxaloacetic acid transminase,1} from Difco Laboratories, yeast extract from Oriental glutamate-pyruvic acid transaminase2) and Yeast Co., amido black 10B from E.
    [Show full text]
  • Pullulan Ω-Carboxyalkanoates for Drug Nanodispersions Jameison T
    Pullulan ω-carboxyalkanoates for Drug Nanodispersions Jameison Theophilus Rolle Thesis submitted to the faculty of the Virginia Polytechnic Institute and State University in partial fulfillment of the requirements for the degree of Master of Science In Macromolecular Science and Engineering Kevin J. Edgar, Committee Chair Richey Davis Lynne S. Taylor July 30th, 2015 Blacksburg, VA Keywords: pullulan, amorphous solid dispersions, carboxyalkanoates, drug delivery Copyright 2015, Jameison T. Rolle Pullulan ω-carboxyalkanoates for Drug Nanodispersions Jameison T. Rolle Abstract Pullulan is an exopolysaccharide secreted extracellularly by the black yeast-like fungi Aureobasidium pullulans. Due to an α-(1→6) linked maltotriose repeat unit, which interferes with hydrogen bonding and crystallization, pullulan is completely water soluble unlike cellulose. It has also been tested and shown to possess non-toxic, biodegradable, non-mutagenic and non- carcinogenic properties. Chemical modification of polysaccharides to increased hydrophobicity and increase functionality has shown great promise in drug delivery systems. Particularly in amorphous solid dispersion (ASD) formulations, hydrophobicity increases miscibility with hydrophobic, crystalline drugs and carboxy functionality provides stabilization with drug moieties and well as pH specific release. Successful synthesis of cellulose ω-carboxyalkanoates have been reported and showed great promise as ASD polymers based on their ability to retard the recrystallization of the HIV drug ritonavir and antibacterial clarithromycin. However, these cellulose derivatives have limitations due to their limited water solubility. Natural pullulan is water-soluble and modification with ω-carboxyalkanoate groups would provide a unique set of derivatives with increased solubility therefore stronger polymer-drug interactions in solution. We have successfully prepared novel pullulan ω-carboxyalkanoates, which exhibit good solubility in polar aprotic and polar protic solvents.
    [Show full text]
  • Biological Stains & Dyes
    BIOLOGICAL STAINS & DYES Developed for Biology, microbiology & industrial applications ACRIFLAVIN ALCIAN BLUE 8GX ACRIDINE ORANGE ALIZARINE CYANINE GREEN ANILINE BLUE (SPIRIT SOLUBLE) www.lobachemie.com BIOLOGICAL STAINS & DYES Staining is an important technique used in microscopy to enhance contrast in the microscopic image. Stains and dyes are frequently used in biology and medicine to highlight structures in biological tissues. Loba Chemie offers comprehensive range of Stains and dyes, which are frequently used in Microbiology, Hematology, Histology, Cytology, Protein and DNA Staining after Electrophoresis and Fluorescence Microscopy etc. Many of our stains and dyes have specifications complying certified grade of Biological Stain Commission, and suitable for biological research. Stringent testing on all batches is performed to ensure consistency and satisfy necessary specification particularly in challenging work such as histology and molecular biology. Stains and dyes offer by Loba chemie includes Dry – powder form Stains and dyes as well as wet - ready to use solutions. Features: • Ideally suited to molecular biology or microbiology applications • Available in a wide range of innovative chemical packaging options. Range of Biological Stains & Dyes Product Code Product Name C.I. No CAS No 00590 ACRIDINE ORANGE 46005 10127-02-3 00600 ACRIFLAVIN 46000 8063-24-9 00830 ALCIAN BLUE 8GX 74240 33864-99-2 00840 ALIZARINE AR 58000 72-48-0 00852 ALIZARINE CYANINE GREEN 61570 4403-90-1 00980 AMARANTH 16185 915-67-3 01010 AMIDO BLACK 10B 20470
    [Show full text]