DOCSLIB.ORG

Supplementary Data

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Supplementary Data Legends Supplementary Figure S1: Effect of MRK-003 on medulloblastoma cell line DAOY. A, Hes1 mRNA in response to treatment with MRK-003. B, Western blot and quantification of Hes1 protein after MRK-003 treatment (M). C, MTS assay measuring cell growth after MRK-003 treatment. D, QPCR of other pathway targets in response to MRK-003 treatment. * P <0.05, * P<0.005, using Student’s t-test. Supplementary Figure S2: A, Hes1 and Hes5 expression after treatment with cyclopamine. B, ChIP of Hes1 in JHH-GBM10. C, ChIP of Hes1 measured via quantitative PCR in DAOY. D, Hes5 expression after infection with NICD2 virus. Supplementary Figure S3: A, MTS assay measuring DAOY growth after treatment with vehicle, 0.4 M MRK-003, 10 M Cyclopamine, or both. B, Response of low passage GBM-derived neurosphere lines to MRK-003. Supplementary Table S1: Primers used for chromatin immunoprecipitation. Supplementary Table S2: List of top genes altered by treatment with MRK-003. Primer Name Forward Reverse GAG GCA ACA GAG CCA CTA GG CAA GTC CAG AAG ACA CTC CTT TCC Gli Nbox0.5 AGA ATG ACC CCA TGC AAT TT CCT GAG GTC AGA GGG TCA AG CTC CAC CAT TAT CTC CCT GGC ATC GAC ACC TTA GGT TGC TGG TTA TAG CAG Gli Nbox1.1 CTC CCC CTC CAC CAT TAT CT GGA CAC CTT AGG TTG CTG GT GTG TAG CCC CAT TTC CTT GGA GGC TCT TC CAG GGG AAG GAG GGA AGT TTG CAA ATG ATC Gli Nbox 1.9 AGC CTG AAG GGG AGA TAT GG GGA GGG AAG TTT GCA AAT GA CCT GAT TTA AAC TAC CCC AGA ATA ACA CC CAC AAG CCA TCT GCC CTC TTA GAC Gli Nbox2.5 AGA TTG TAC ACG GGC TGT CC TGG ACC CTC TAA TTC TTC TTG C CAC GAG AAG GAA GGG GGA ACG CCT CTA ATT CTT CTT GCT GTA ACC CTG G Gli Nbox2.7 ACA CAG ACC ACA CAG GCA AA AGG GGT AAG GGG AAA TGA TG p27 GTG CAA TGG CAT GAT CAT AGC TCA CTG GTC AGA GTC CTT GCC TGT GGG Hes1 CGT GTC TCC TCC TCC CAT T GGC CTC TAT ATA TAT CTG GGA CTG C p63 GAA CAA CAG TAG AGA GGA TGC CCA GC GCT ATC AGA CAT AGA AGT TTA GGC ACT TCT CTC C Adjusted P- LnFC P. Value EntrezID Symbol Gene Name value 1.053 5.87E-17 9.46E-15 19 ABCA1 ATP-binding cassette sub-family A (ABC1) member 1 -0.626 1.05E-19 2.92E-17 39 ACAT2 acetyl-Coenzyme A acetyltransferase 2 -0.3997 3.15E-17 5.46E-15 79611 ACSS3 acyl-CoA synthetase short-chain family member 3 -0.4334 1.61E-17 2.94E-15 9465 AKAP7 A kinase (PRKA) anchor protein 7 aldo-keto reductase family 1 member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid -0.4227 9.55E-21 3.45E-18 1645 AKR1C1 dehydrogenase) -0.4444 5.52E-19 1.32E-16 9068 ANGPTL1 angiopoietin-like 1 -0.5592 1.87E-20 6.14E-18 307 ANXA4 annexin A4 apolipoprotein B mRNA editing enzyme catalytic -0.4814 3.73E-19 9.24E-17 60489 APOBEC3G polypeptide-like 3G 0.4908 4.73E-17 7.89E-15 50649 ARHGEF4 Rho guanine nucleotide exchange factor (GEF) 4 -0.9672 2.68E-22 1.81E-19 9823 ARMCX2 armadillo repeat containing X-linked 2 -0.4179 2.93E-21 1.22E-18 140462 ASB9 ankyrin repeat and SOCS box-containing 9 -0.8313 2.63E-21 1.11E-18 10409 BASP1 brain abundant membrane attached signal protein 1 0.7588 3.72E-19 9.24E-17 27113 BBC3 BCL2 binding component 3 butyrobetaine (gamma) 2-oxoglutarate dioxygenase -0.6208 4.42E-23 3.99E-20 8424 BBOX1 (gamma-butyrobetaine hydroxylase) 1 0.4289 4.05E-20 1.21E-17 605 BCL7A B-cell CLL/lymphoma 7A -0.5798 1.47E-18 3.31E-16 79365 BHLHE41 basic helix-loop-helix family member e41 -0.4236 2.14E-17 3.79E-15 642938 C10orf141 chromosome 10 open reading frame 141 -0.8444 4.68E-24 6.55E-21 715 C1R complement component 1 r subcomponent -0.5754 1.14E-20 4.02E-18 716 C1S complement component 1 s subcomponent -0.498 7.86E-22 4.16E-19 24141 C20orf103 chromosome 20 open reading frame 103 -0.4197 1.50E-17 2.80E-15 51313 C4orf18 chromosome 4 open reading frame 18 -0.4496 3.65E-20 1.10E-17 414328 C9orf103 chromosome 9 open reading frame 103 -0.4505 3.31E-18 7.19E-16 84302 C9orf125 chromosome 9 open reading frame 125 -0.4422 1.54E-17 2.87E-15 375759 C9orf50 chromosome 9 open reading frame 50 -0.4112 1.56E-17 2.90E-15 11092 C9orf9 chromosome 9 open reading frame 9 chaperone ABC1 activity of bc1 complex homolog (S. 0.4816 3.44E-17 5.88E-15 56997 CABC1 pombe) -0.5531 9.98E-18 1.95E-15 837 CASP4 caspase 4 apoptosis-related cysteine peptidase -0.3801 4.98E-17 8.20E-15 831 CAST calpastatin -0.9424 1.92E-23 2.01E-20 857 CAV1 caveolin 1 caveolae protein 22kDa -1.108 1.37E-20 4.73E-18 6347 CCL2 chemokine (C-C motif) ligand 2 0.4739 1.97E-19 5.18E-17 595 CCND1 cyclin D1 0.3758 4.04E-18 8.47E-16 64405 CDH22 cadherin-like 22 -0.379 6.52E-18 1.30E-15 1069 CETN2 centrin EF-hand protein 2 -0.595 4.90E-19 1.19E-16 3426 CFI complement factor I -0.7333 1.10E-17 2.11E-15 9435 CHST2 carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2 -0.4991 1.18E-17 2.25E-15 1266 CNN3 calponin 3 acidic -0.4646 2.74E-20 8.79E-18 1268 CNR1 cannabinoid receptor 1 (brain) -0.5089 1.76E-20 5.82E-18 1278 COL1A2 collagen type I alpha 2 -0.479 2.29E-19 5.90E-17 1280 COL2A1 collagen type II alpha 1 -0.4314 1.62E-17 2.94E-15 1363 CPE carboxypeptidase E 0.4355 1.57E-18 3.50E-16 10815 CPLX1 complexin 1 -0.4502 3.03E-20 9.46E-18 1368 CPM carboxypeptidase M -1.199 4.66E-32 8.85E-28 57699 CPNE5 copine V -0.7984 1.04E-21 5.18E-19 126129 CPT1C carnitine palmitoyltransferase 1C -0.485 9.48E-19 2.18E-16 54504 CPVL carboxypeptidase vitellogenic-like 0.5076 4.88E-17 8.11E-15 23418 CRB1 crumbs homolog 1 (Drosophila) -0.608 2.67E-18 5.81E-16 115908 CTHRC1 collagen triple helix repeat containing 1 -0.5363 6.42E-19 1.51E-16 51700 CYB5R2 cytochrome b5 reductase 2 -0.5833 1.04E-21 5.18E-19 1573 CYP2J2 cytochrome P450 family 2 subfamily J polypeptide 2 -0.5624 7.71E-18 1.52E-15 1595 CYP51A1 cytochrome P450 family 51 subfamily A polypeptide 1 -0.5446 4.43E-17 7.41E-15 79132 DHX58 DEXH (Asp-Glu-X-His) box polypeptide 58 0.8281 1.15E-21 5.56E-19 28514 DLL1 delta-like 1 (Drosophila) 0.8111 3.15E-26 9.75E-23 10683 DLL3 delta-like 3 (Drosophila) -0.4879 9.86E-20 2.81E-17 81704 DOCK8 dedicator of cytokinesis 8 0.5644 1.44E-21 6.66E-19 1826 DSCAM Down syndrome cell adhesion molecule 0.8077 5.36E-23 4.65E-20 253738 EBF3 early B-cell factor 3 -0.6784 4.89E-24 6.61E-21 2202 EFEMP1 EGF-containing fibulin-like extracellular matrix protein 1 0.585 8.01E-24 9.66E-21 9086 EIF1AY eukaryotic translation initiation factor 1A Y-linked ELAV (embryonic lethal abnormal vision Drosophila)-like 4 0.5655 1.36E-17 2.57E-15 1996 ELAVL4 (Hu antigen D) -1.281 6.71E-21 2.57E-18 2012 EMP1 epithelial membrane protein 1 0.6575 3.25E-19 8.14E-17 2018 EMX2 empty spiracles homeobox 2 0.5784 3.97E-22 2.43E-19 196047 EMX2OS EMX2 opposite strand (non-protein coding) -0.59 5.72E-22 3.22E-19 55556 ENOSF1 enolase superfamily member 1 v-erb-b2 erythroblastic leukemia viral oncogene homolog 2 -0.6474 3.06E-17 5.33E-15 2064 ERBB2 neuro/glioblastoma derived oncogene homolog (avian) -0.6945 9.63E-22 4.97E-19 63901 FAM111A family with sequence similarity 111 member A -0.7939 5.33E-24 6.61E-21 116496 FAM129A family with sequence similarity 129 member A -0.5455 1.24E-19 3.40E-17 2258 FGF13 fibroblast growth factor 13 0.3892 1.62E-17 2.94E-15 1E+08 FLJ25694 hypothetical protein FLJ25694 -0.7746 1.67E-21 7.46E-19 2331 FMOD fibromodulin -0.3966 5.77E-17 9.34E-15 2335 FN1 fibronectin 1 -0.3082 3.58E-17 6.09E-15 257019 FRMD3 FERM domain containing 3 -0.3763 4.29E-17 7.23E-15 84978 FRMD5 FERM domain containing 5 -0.4947 1.52E-21 6.95E-19 2487 FRZB frizzled-related protein -0.5582 9.88E-22 5.04E-19 8325 FZD8 frizzled homolog 8 (Drosophila) -1.026 3.33E-23 3.14E-20 9568 GABBR2 gamma-aminobutyric acid (GABA) B receptor 2 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N- -0.6138 1.02E-20 3.66E-18 11227 GALNT5 acetylgalactosaminyltransferase 5 (GalNAc-T5) -0.5602 2.19E-18 4.88E-16 2596 GAP43 growth associated protein 43 glycine amidinotransferase (L-arginine:glycine -0.6034 1.84E-17 3.31E-15 2628 GATM amidinotransferase) H19 imprinted maternally expressed transcript (non- 0.988 6.31E-18 1.27E-15 283120 H19 protein coding) -1.105 5.18E-24 6.61E-21 3280 HES1 hairy and enhancer of split 1 (Drosophila) -3.006 1.44E-26 5.68E-23 388585 HES5 hairy and enhancer of split 5 (Drosophila) -1.517 1.66E-33 7.22E-29 23462 HEY1 hairy/enhancer-of-split related with YRPW motif 1 -0.572 1.27E-19 3.47E-17 23493 HEY2 hairy/enhancer-of-split related with YRPW motif 2 -0.5145 3.08E-20 9.47E-18 85236 HIST1H2BK histone cluster 1 H2bk -0.9026 6.76E-17 1.09E-14 3106 HLA-B major histocompatibility complex class I B -0.8094 2.45E-17 4.30E-15 3107 HLA-C major histocompatibility complex class I C -0.5084 3.89E-18 8.24E-16 3127 HLA-DRB5 major histocompatibility complex class II DR beta 5 -0.5544 4.97E-21 1.98E-18 3133 HLA-E major histocompatibility complex class I E -0.5295 2.78E-19 7.02E-17 221883 HOXA11AS HOXA11 antisense RNA (non-protein coding) -0.4899 1.16E-19 3.19E-17 3201 HOXA4 homeobox A4 -0.5047 2.83E-20 8.92E-18 3202 HOXA5 homeobox A5 -0.7886 7.70E-21 2.83E-18 3204 HOXA7 homeobox A7 -0.6412 1.73E-20 5.77E-18 3205 HOXA9 homeobox A9 -0.5775 7.82E-18 1.53E-15 3225 HOXC9 homeobox C9 -0.6238 1.37E-17 2.57E-15 51478 HSD17B7 hydroxysteroid (17-beta) dehydrogenase 7 -0.5427 6.21E-23 5.18E-20 158160 HSD17B7P2 hydroxysteroid (17-beta) dehydrogenase 7 pseudogene 2 -0.6634 2.17E-24 3.77E-21 259217 HSPA12A heat shock 70kDa protein 12A -0.5057 3.36E-22 2.11E-19 10553 HTATIP2 HIV-1 Tat interactive protein 2 30kDa isoamyl acetate-hydrolyzing esterase 1 homolog (S.
Load more

Recommended publications
  • University of Leicester, Msc Medical Statistics, Thesis, Wilmar
    Thesis MSc in Medical Statistics Department of Health Sciences University of Leicester, United Kingdom Application of Bayesian hierarchical generalized linear models using weakly informative prior distributions to identify rare genetic variant effects on blood pressure Wilmar Igl March 2015 Summary Background Currently rare genetic variants are discussed as a source of \missing heritability" of complex traits. Bayesian hierarchical models were proposed as an efficient method for the estimation and aggregation of conditional effects of rare variants. Here, such models are applied to identify rare variant effects on blood pressure. Methods Empirical data provided by the Genetic Analysis Workshop 19 (2014) included 1,851 Mexican-American individuals with diastolic blood pressure (DBP), systolic blood pressure (SBP), hypertension (HTN) and 461,868 variants from whole- exome sequencing of odd-numbered chromosomes. Bayesian hierarchical generalized linear models using weakly informative prior distributions were applied. Results Associations of rare variants chr1:204214013 (estimate = 39.6, Credible In- terval (CrI) 95% = [25.3, 53.9], Bayesian p = 6:8 × 10−8) in the PLEKHA6 gene and chr11:118518698 (estimate = 32.2, CrI95% = [20.6, 43.9], Bayesian p = 7:0 × 10−8) in the PHLEDB1 gene were identified. Joint effects of grouped rare variants on DBP in 23 genes (Bayesian p = [8:8 × 10−14, 9:3 × 10−8]) and on SBP in 21 genes (Bayesian p = [8:6 × 10−12, 7:8 × 10−8]) in pathways related to hemostasis, sodi- um/calcium transport, ciliary activity, and others were found. No association with hypertension was detected. Conclusions Bayesian hierarchical generalized linear models with weakly informa- tive priors can successfully be applied in exome-wide genetic association analyses of rare variants.
    [Show full text]
  • Appendix 2. Significantly Differentially Regulated Genes in Term Compared with Second Trimester Amniotic Fluid Supernatant
    Appendix 2. Significantly Differentially Regulated Genes in Term Compared With Second Trimester Amniotic Fluid Supernatant Fold Change in term vs second trimester Amniotic Affymetrix Duplicate Fluid Probe ID probes Symbol Entrez Gene Name 1019.9 217059_at D MUC7 mucin 7, secreted 424.5 211735_x_at D SFTPC surfactant protein C 416.2 206835_at STATH statherin 363.4 214387_x_at D SFTPC surfactant protein C 295.5 205982_x_at D SFTPC surfactant protein C 288.7 1553454_at RPTN repetin solute carrier family 34 (sodium 251.3 204124_at SLC34A2 phosphate), member 2 238.9 206786_at HTN3 histatin 3 161.5 220191_at GKN1 gastrokine 1 152.7 223678_s_at D SFTPA2 surfactant protein A2 130.9 207430_s_at D MSMB microseminoprotein, beta- 99.0 214199_at SFTPD surfactant protein D major histocompatibility complex, class II, 96.5 210982_s_at D HLA-DRA DR alpha 96.5 221133_s_at D CLDN18 claudin 18 94.4 238222_at GKN2 gastrokine 2 93.7 1557961_s_at D LOC100127983 uncharacterized LOC100127983 93.1 229584_at LRRK2 leucine-rich repeat kinase 2 HOXD cluster antisense RNA 1 (non- 88.6 242042_s_at D HOXD-AS1 protein coding) 86.0 205569_at LAMP3 lysosomal-associated membrane protein 3 85.4 232698_at BPIFB2 BPI fold containing family B, member 2 84.4 205979_at SCGB2A1 secretoglobin, family 2A, member 1 84.3 230469_at RTKN2 rhotekin 2 82.2 204130_at HSD11B2 hydroxysteroid (11-beta) dehydrogenase 2 81.9 222242_s_at KLK5 kallikrein-related peptidase 5 77.0 237281_at AKAP14 A kinase (PRKA) anchor protein 14 76.7 1553602_at MUCL1 mucin-like 1 76.3 216359_at D MUC7 mucin 7,
    [Show full text]
  • SF3B1-Mutated Chronic Lymphocytic Leukemia Shows Evidence Of
    SF3B1-mutated chronic lymphocytic leukemia shows evidence of NOTCH1 pathway activation including CD20 downregulation by Federico Pozzo, Tamara Bittolo, Erika Tissino, Filippo Vit, Elena Vendramini, Luca Laurenti, Giovanni D'Arena, Jacopo Olivieri, Gabriele Pozzato, Francesco Zaja, Annalisa Chiarenza, Francesco Di Raimondo, Antonella Zucchetto, Riccardo Bomben, Francesca Maria Rossi, Giovanni Del Poeta, Michele Dal Bo, and Valter Gattei Haematologica 2020 [Epub ahead of print] Citation: Federico Pozzo, Tamara Bittolo, Erika Tissino, Filippo Vit, Elena Vendramini, Luca Laurenti, Giovanni D'Arena, Jacopo Olivieri, Gabriele Pozzato, Francesco Zaja, Annalisa Chiarenza, Francesco Di Raimondo, Antonella Zucchetto, Riccardo Bomben, Francesca Maria Rossi, Giovanni Del Poeta, Michele Dal Bo, and Valter Gattei SF3B1-mutated chronic lymphocytic leukemia shows evidence of NOTCH1 pathway activation including CD20 downregulation. Haematologica. 2020; 105:xxx doi:10.3324/haematol.2020.261891 Publisher's Disclaimer. E-publishing ahead of print is increasingly important for the rapid dissemination of science. Haematologica is, therefore, E-publishing PDF files of an early version of manuscripts that have completed a regular peer review and have been accepted for publication. E-publishing of this PDF file has been approved by the authors. After having E-published Ahead of Print, manuscripts will then undergo technical and English editing, typesetting, proof correction and be presented for the authors' final approval; the final version of the manuscript will
    [Show full text]
  • Hypoxia As an Evolutionary Force
    “The genetic architecture of adaptations to high altitude in Ethiopia” Gorka Alkorta-Aranburu1, Cynthia M. Beall2*, David B. Witonsky1, Amha Gebremedhin3, Jonathan K. Pritchard1,4, Anna Di Rienzo1* 1 Department of Human Genetics, University of Chicago, Chicago, Illinois, United States of America, 2 Department of Anthropology, Case Western Research University, Cleveland, Ohio, United States of America, 3 Department of Internal Medicine, Faculty of Medicine, Addis Ababa University, Addis Ababa, Ethiopia, 4 Howard Hughes Medical Institute * E-mail: [email protected] and [email protected] Corresponding authors: Anna Di Rienzo Department of Human Genetics University of Chicago 920 E. 58th Street Chicago, IL 60637, USA. Cynthia M. Beall Anthropology Department Case Western Reserve University 238 Mather Memorial Building 11220 Bellflower Road Cleveland, OH 44106, USA. 1 ABSTRACT Although hypoxia is a major stress on physiological processes, several human populations have survived for millennia at high altitudes, suggesting that they have adapted to hypoxic conditions. This hypothesis was recently corroborated by studies of Tibetan highlanders, which showed that polymorphisms in candidate genes show signatures of natural selection as well as well-replicated association signals for variation in hemoglobin levels. We extended genomic analysis to two Ethiopian ethnic groups: Amhara and Oromo. For each ethnic group, we sampled low and high altitude residents, thus allowing genetic and phenotypic comparisons across altitudes and across ethnic groups. Genome- wide SNP genotype data were collected in these samples by using Illumina arrays. We find that variants associated with hemoglobin variation among Tibetans or other variants at the same loci do not influence the trait in Ethiopians.
    [Show full text]
  • In Vitro and in Vivo Blood Compatibility of Concentrated Polymer Brushes
    Electronic Supplementary Material (ESI) for Journal of Materials Chemistry B. This journal is © The Royal Society of Chemistry 2021 Electric Supplementary Information In vitro and In vivo Blood Compatibility of Concentrated Polymer Brushes Chiaki Yoshikawa,1* Shinya Hattori,2 Chih-Feng Huang,1,3 Hisatoshi Kobayashi,4 Masaru Tanaka5,6* 1Research Center for Functional Materials, National Institute for Materials Science (NIMS), Tsukuba, Ibaraki 305-0047, Japan 2NIMS Molecular & Material Synhtesis Platform, NIMS, Tsukuba, Ibaraki 305-0047, Japan 3 Department of Chemical Engineering, i-Center for Advanced Science and Technology (iCAST), National Chung Hsing University, Taichung 402-27, Taiwan 4WPI-MANA, NIMS, Tsukuba, Ibaraki 305-0047, Japan 5Soft Materials Chemistry, Institute for Materials Chemistry and Engineering, Kyushu University, Build. CE41, 744 Motooka Nishi-ku, Fukuoka 819-0395, Japan 6Former Frontier Center for Organic Materials, Yamagata University, 4-3-16 Jonan, Yonezawa, Yamagata 992-8510, Japan Corresponding authors: [email protected] and masaru [email protected] u.ac.jp 1 Material and Methods HUVEC adhesion test. Human umbilical vein endothelial cells (HUVEC) (LONZA, Switzerland) were cultured in endothelial basal medium 2 (LONZA) supplemented with EGM-2 SingleQuots (LONZA) (2% o FBS) at 37 C in a humidified atmosphere of air containing 5% CO2. At subconfluence, the cells were removed from the tissue culture plate polystyrene (TCPS) by trypsin treatment. The concentration of the HUVECs was adjusted to 1104 cells/cm2 and the cells were seeded on o samples and cultured for 24 h at 37 C in a humidified atmosphere of air containing 5 % CO2. After the medium was aspirated, the substrate was softly rinsed three times with fresh PBS and placed in 2 % glutaraldehyde in phosphate buffer (PB) for overnight at 4 oC to fix the adherent cells on the samples.
    [Show full text]
  • PRODUCT SPECIFICATION Prest Antigen C9orf50 Product
    PrEST Antigen C9orf50 Product Datasheet PrEST Antigen PRODUCT SPECIFICATION Product Name PrEST Antigen C9orf50 Product Number APrEST75392 Gene Description chromosome 9 open reading frame 50 Alternative Gene FLJ35803 Names Corresponding Anti-C9orf50 (HPA026743) Antibodies Description Recombinant protein fragment of Human C9orf50 Amino Acid Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: HSQFTTVRKANQPHGAQVPRLKAALTHNPSGEGSRPCRQRCPFRVRFADE TLQDTTLRYWERRRSVQQSVIVNQKAALPVASERVFGSVGK Fusion Tag N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) Expression Host E. coli Purification IMAC purification Predicted MW 28 kDa including tags Usage Suitable as control in WB and preadsorption assays using indicated corresponding antibodies. Purity >80% by SDS-PAGE and Coomassie blue staining Buffer PBS and 1M Urea, pH 7.4. Unit Size 100 µl Concentration Lot dependent Storage Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions. Atlas Antibodies AB's sole liability is limited to replacement of the product or refund of the purchase price.
    [Show full text]
  • Mrna Expression in Human Leiomyoma and Eker Rats As Measured by Microarray Analysis
    Table 3S: mRNA Expression in Human Leiomyoma and Eker Rats as Measured by Microarray Analysis Human_avg Rat_avg_ PENG_ Entrez. Human_ log2_ log2_ RAPAMYCIN Gene.Symbol Gene.ID Gene Description avg_tstat Human_FDR foldChange Rat_avg_tstat Rat_FDR foldChange _DN A1BG 1 alpha-1-B glycoprotein 4.982 9.52E-05 0.68 -0.8346 0.4639 -0.38 A1CF 29974 APOBEC1 complementation factor -0.08024 0.9541 -0.02 0.9141 0.421 0.10 A2BP1 54715 ataxin 2-binding protein 1 2.811 0.01093 0.65 0.07114 0.954 -0.01 A2LD1 87769 AIG2-like domain 1 -0.3033 0.8056 -0.09 -3.365 0.005704 -0.42 A2M 2 alpha-2-macroglobulin -0.8113 0.4691 -0.03 6.02 0 1.75 A4GALT 53947 alpha 1,4-galactosyltransferase 0.4383 0.7128 0.11 6.304 0 2.30 AACS 65985 acetoacetyl-CoA synthetase 0.3595 0.7664 0.03 3.534 0.00388 0.38 AADAC 13 arylacetamide deacetylase (esterase) 0.569 0.6216 0.16 0.005588 0.9968 0.00 AADAT 51166 aminoadipate aminotransferase -0.9577 0.3876 -0.11 0.8123 0.4752 0.24 AAK1 22848 AP2 associated kinase 1 -1.261 0.2505 -0.25 0.8232 0.4689 0.12 AAMP 14 angio-associated, migratory cell protein 0.873 0.4351 0.07 1.656 0.1476 0.06 AANAT 15 arylalkylamine N-acetyltransferase -0.3998 0.7394 -0.08 0.8486 0.456 0.18 AARS 16 alanyl-tRNA synthetase 5.517 0 0.34 8.616 0 0.69 AARS2 57505 alanyl-tRNA synthetase 2, mitochondrial (putative) 1.701 0.1158 0.35 0.5011 0.6622 0.07 AARSD1 80755 alanyl-tRNA synthetase domain containing 1 4.403 9.52E-05 0.52 1.279 0.2609 0.13 AASDH 132949 aminoadipate-semialdehyde dehydrogenase -0.8921 0.4247 -0.12 -2.564 0.02993 -0.32 AASDHPPT 60496 aminoadipate-semialdehyde
    [Show full text]
  • A Meta-Analysis of the Effects of High-LET Ionizing Radiations in Human Gene Expression
    Supplementary Materials A Meta-Analysis of the Effects of High-LET Ionizing Radiations in Human Gene Expression Table S1. Statistically significant DEGs (Adj. p-value < 0.01) derived from meta-analysis for samples irradiated with high doses of HZE particles, collected 6-24 h post-IR not common with any other meta- analysis group. This meta-analysis group consists of 3 DEG lists obtained from DGEA, using a total of 11 control and 11 irradiated samples [Data Series: E-MTAB-5761 and E-MTAB-5754]. Ensembl ID Gene Symbol Gene Description Up-Regulated Genes ↑ (2425) ENSG00000000938 FGR FGR proto-oncogene, Src family tyrosine kinase ENSG00000001036 FUCA2 alpha-L-fucosidase 2 ENSG00000001084 GCLC glutamate-cysteine ligase catalytic subunit ENSG00000001631 KRIT1 KRIT1 ankyrin repeat containing ENSG00000002079 MYH16 myosin heavy chain 16 pseudogene ENSG00000002587 HS3ST1 heparan sulfate-glucosamine 3-sulfotransferase 1 ENSG00000003056 M6PR mannose-6-phosphate receptor, cation dependent ENSG00000004059 ARF5 ADP ribosylation factor 5 ENSG00000004777 ARHGAP33 Rho GTPase activating protein 33 ENSG00000004799 PDK4 pyruvate dehydrogenase kinase 4 ENSG00000004848 ARX aristaless related homeobox ENSG00000005022 SLC25A5 solute carrier family 25 member 5 ENSG00000005108 THSD7A thrombospondin type 1 domain containing 7A ENSG00000005194 CIAPIN1 cytokine induced apoptosis inhibitor 1 ENSG00000005381 MPO myeloperoxidase ENSG00000005486 RHBDD2 rhomboid domain containing 2 ENSG00000005884 ITGA3 integrin subunit alpha 3 ENSG00000006016 CRLF1 cytokine receptor like
    [Show full text]
  • Table S1. 103 Ferroptosis-Related Genes Retrieved from the Genecards
    Table S1. 103 ferroptosis-related genes retrieved from the GeneCards. Gene Symbol Description Category GPX4 Glutathione Peroxidase 4 Protein Coding AIFM2 Apoptosis Inducing Factor Mitochondria Associated 2 Protein Coding TP53 Tumor Protein P53 Protein Coding ACSL4 Acyl-CoA Synthetase Long Chain Family Member 4 Protein Coding SLC7A11 Solute Carrier Family 7 Member 11 Protein Coding VDAC2 Voltage Dependent Anion Channel 2 Protein Coding VDAC3 Voltage Dependent Anion Channel 3 Protein Coding ATG5 Autophagy Related 5 Protein Coding ATG7 Autophagy Related 7 Protein Coding NCOA4 Nuclear Receptor Coactivator 4 Protein Coding HMOX1 Heme Oxygenase 1 Protein Coding SLC3A2 Solute Carrier Family 3 Member 2 Protein Coding ALOX15 Arachidonate 15-Lipoxygenase Protein Coding BECN1 Beclin 1 Protein Coding PRKAA1 Protein Kinase AMP-Activated Catalytic Subunit Alpha 1 Protein Coding SAT1 Spermidine/Spermine N1-Acetyltransferase 1 Protein Coding NF2 Neurofibromin 2 Protein Coding YAP1 Yes1 Associated Transcriptional Regulator Protein Coding FTH1 Ferritin Heavy Chain 1 Protein Coding TF Transferrin Protein Coding TFRC Transferrin Receptor Protein Coding FTL Ferritin Light Chain Protein Coding CYBB Cytochrome B-245 Beta Chain Protein Coding GSS Glutathione Synthetase Protein Coding CP Ceruloplasmin Protein Coding PRNP Prion Protein Protein Coding SLC11A2 Solute Carrier Family 11 Member 2 Protein Coding SLC40A1 Solute Carrier Family 40 Member 1 Protein Coding STEAP3 STEAP3 Metalloreductase Protein Coding ACSL1 Acyl-CoA Synthetase Long Chain Family Member 1 Protein
    [Show full text]
  • Mass Spectrometry-Based Proteomics Analysis of Bioactive Proteins in EMD That Modulate Adhesion of Gingival Fibroblast to Improve Bio-Integration of Dental Implants
    Western University Scholarship@Western Electronic Thesis and Dissertation Repository 3-28-2019 3:00 PM Mass Spectrometry-Based Proteomics Analysis Of Bioactive Proteins In EMD That Modulate Adhesion Of Gingival Fibroblast To Improve Bio-Integration Of Dental Implants David Zuanazzi Machado Jr The University of Western Ontario Supervisor Siqueira, Walter L. The University of Western Ontario Graduate Program in Biochemistry A thesis submitted in partial fulfillment of the equirr ements for the degree in Doctor of Philosophy © David Zuanazzi Machado Jr 2019 Follow this and additional works at: https://ir.lib.uwo.ca/etd Part of the Biochemistry Commons, Dental Materials Commons, Oral Biology and Oral Pathology Commons, and the Periodontics and Periodontology Commons Recommended Citation Zuanazzi Machado, David Jr, "Mass Spectrometry-Based Proteomics Analysis Of Bioactive Proteins In EMD That Modulate Adhesion Of Gingival Fibroblast To Improve Bio-Integration Of Dental Implants" (2019). Electronic Thesis and Dissertation Repository. 6064. https://ir.lib.uwo.ca/etd/6064 This Dissertation/Thesis is brought to you for free and open access by Scholarship@Western. It has been accepted for inclusion in Electronic Thesis and Dissertation Repository by an authorized administrator of Scholarship@Western. For more information, please contact [email protected]. i ABSTRACT Titanium (Ti) implants are used in dental practice to replace damaged or lost teeth. For effective treatment, the dental implant needs to integrate with the surrounding hard and soft tissues on the implant site. Despite improvements in bone-implant integration that have been achieved through surface modifications, the integration with the soft tissues is still deficient. The oral mucosa that embraces the transmucosal component of the implant only contacts the surface without making a strong attachment with the connective tissue.
    [Show full text]
  • Genomic Segmental Duplications on the Basis of the T(9;22) Rearrangement in Chronic Myeloid Leukemia
    Oncogene (2010) 29, 2509–2516 & 2010 Macmillan Publishers Limited All rights reserved 0950-9232/10 $32.00 www.nature.com/onc ORIGINAL ARTICLE Genomic segmental duplications on the basis of the t(9;22) rearrangement in chronic myeloid leukemia F Albano1,3, L Anelli1,3, A Zagaria1,3, N Coccaro1, P D’Addabbo2, V Liso1, M Rocchi2,4 and G Specchia1,4 1Department of Hematology, University of Bari, Bari, Italy and 2Department of Genetics and Microbiology, University of Bari, Bari, Italy A crucial role of segmental duplications (SDs) of the (SDs) in triggering constitutional and also tumor human genome has been shown in chromosomal re- chromosomal abnormalities (Sharp et al., 2006; Gibcus arrangements associated with several genomic disorders. et al., 2007; Darai-Ramqvist et al., 2008; Gu et al., 2008; Limited knowledge is yet available on the molecular Mefford and Eichler, 2009). Several rearrangements processes resulting in chromosomal rearrangements in have been described so far to explain the occurrence of tumors. The t(9;22)(q34;q11) rearrangement causing the genomic disorders: recurrent, sharing a common size 50BCR/30ABL gene formation has been detected in more and showing clustering of breakpoints inside the SDs, than 90% of cases with chronic myeloid leukemia (CML). and nonrecurrent rearrangements, involving regions of In 10–18% of patients with CML, genomic deletions different sizes and showing breakpoints scattering in were detected on der(9) chromosome next to translocation large regions (Gu et al., 2008). Most of the recurrent breakpoints. The molecular mechanism triggering the rearrangements result from a nonallelic homologous t(9;22) and deletions on der(9) is still speculative.
    [Show full text]
  • Mechanisms of Cellular Metabolic Regulation in Short-Term Hypoxia
    Mechanisms of cellular metabolic regulation in short-term hypoxia Fiona Grimm A dissertation submitted in partial fulfilment of the requirements for the degree of Doctor of Philosophy of University College London. Division of Biosciences University College London December 13, 2017 3 Preface I, Fiona Grimm, confirm that the work presented in this thesis is my own. Where infor- mation has been derived from other sources, I confirm that this has been indicated in the work. 5 Abstract In tumours, cell proliferation and inefficient perfusion lead to transient and chronic fluc- tuations of oxygen supply, causing localised hypoxia. A key mechanism for survival in hypoxia is the reprogramming of cellular metabolism, which current evidence suggests is primarily mediated at the transcriptional level by HIF1a. This work demonstrates that well-known, hypoxia-associated metabolic changes, such as increased glycolysis and lactate production, occur within only 3-5 hours at 1% O2 in a HIF1a-independent manner. Concomitant to these changes, intracellular aspartate levels decline, partly through decreased mitochondrial aspartate production, implying al- tered activity of the mitochondrial malate-aspartate shuttle (MAS). Pharmacological and genetic ablation experiments demonstrated that aspartate amino- transferase 1 (GOT1), a component of the MAS, is necessary for upregulation of glycoly- sis in early hypoxia. Loss of GOT1 also limited flux through cytoplasmic redox pathways and glyceraldehyde-3-phosphate dehydrogenase (GAPDH), and decreased the cytoplas- mic NAD+/NADH ratio, suggesting that multiple redox systems collectively account for early hypoxia-induced metabolic changes. Furthermore, lactate dehydrogenase (LDHA) loss of function had a strong inhibitory effect on glycolytic flux, caused increased respira- tion and dependency on OXPHOS-derived ATP,and diversion of glucose carbons into the TCA cycle and fatty acid biosynthesis.
    [Show full text]