Anti-RPS6KA6 Monoclonal Antibody, Clone 9I6 (DMABT-H12544) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Total Page：16

File Type：pdf, Size：1020Kb

Anti-RPS6KA6 monoclonal antibody, clone 9I6 (DMABT-H12544) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Product Overview Mouse Anti-RPS6KA6 Monoclonal Antibody Target RPS6KA6 Immunogen RPS6KA6 (NP_055311.1, 636 a.a. ~ 745 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype IgG2a Source/Host Mouse Species Reactivity Human, Rat Clone 9I6 Conjugate Unconjugated Applications WB, IHC, ELISA Sequence Similarities RIGNGKFSLSGGNWDNISDGAKDLLSHMLHMDPHQRYTAEQILKHSWITHRDQLPNDQPKRND VSHVVKGAMVAT YSALTHKTFQPVLEPVAASSLAQRRSMKKRTSTGL Size 1 ea Buffer In 1x PBS, pH 7.2 Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION Gene Name RPS6KA6 ribosomal protein S6 kinase, 90kDa, polypeptide 6 [ Homo sapiens ] Official Symbol RPS6KA6 Synonyms RPS6KA6; ribosomal protein S6 kinase, 90kDa, polypeptide 6; ribosomal protein S6 kinase, 90kD, polypeptide 6; ribosomal protein S6 kinase alpha-6; RSK4; RSK-4; p90RSK6; p90-RSK 6; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved S6K-alpha 6; S6K-alpha-6; ribosomal S6 kinase 4;00kDa ribosomal protein S6 kinase 6; PP90RSK4; Entrez Gene ID 27330 Protein Refseq NP_055311 UniProt ID Q9UK32 Chromosome Location Xq21.1 Pathway Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; Axon guidance, organism-specific biosystem; CREB phosphorylation through the activation of Ras, organism-specific biosystem; Cytoplasmic Ribosomal Proteins, organism- specific biosystem; Developmental Biology, organism-specific biosystem; Insulin Signaling, organism-specific biosystem; L1CAM interactions, organism-specific biosystem. Function ATP binding; magnesium ion binding; nucleotide binding; protein kinase activity; protein serine/threonine kinase activity; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.

Copy Link

Recommended publications

Human RSK4 / RPS6KA6 Protein (GST Tag)
Human RSK4 / RPS6KA6 Protein (GST Tag) Catalog Number: 10147-H09B General Information SDS-PAGE: Gene Name Synonym: PP90RSK4; RSK4 Protein Construction: A DNA sequence encoding the full length of human RSK4 (NP_055311.1) (Met 1-Leu 745) was fused with the GST tag at the N-terminus. Source: Human Expression Host: Baculovirus-Insect Cells QC Testing Purity: > 85 % as determined by SDS-PAGE Bio Activity： Protein Description No Kinase Activity Ribosomal protein S6 kinase alpha-6, also known as Ribosomal S6 kinase Endotoxin: 4, 90 kDa ribosomal protein S6 kinase 6,RSK-4, RSK4 and RPS6KA6, is a protein which belongs to theprotein kinase superfamily, AGC Ser/Thr < 1.0 EU per μg of the protein as determined by the LAL method protein kinase family and S6 kinase subfamily. RPS6KA6 contains oneAGC-kinase C-terminal domain and twoprotein kinase domains. Stability: RPS6KA6 forms a complex with either ERK1 or ERK2 in quiescent cells. Samples are stable for up to twelve months from date of receipt at -70 ℃ RPS6KA6 shows a high level of homology to three isolated members of the human RSK family. RSK2 is involved in Coffin-Lowry syndrome and Predicted N terminal: Met nonspecific MRX. The localization of RPS6KA6 in the interval that is commonly deleted in mentally retarded males together with the high degree Molecular Mass: of amino acid identity with RSK2 suggests that RPS6KA6 plays a role in normal neuronal development. Further mutation analyses in males with X- The recombinant human RSK4/GST chimera consists of 972 amino acids and linked mental retardation must prove that the gene of RPS6KA6 is indeed a migrates as an approximately 110 kDa band as predicted in SDS-PAGE under novel MRX gene.
[Show full text]
1 Meiotic Sex Chromosome Inactivation Is Disrupted in Sterile
Genetics: Early Online, published on January 10, 2013 as 10.1534/genetics.112.148635 Meiotic sex chromosome inactivation is disrupted in sterile hybrid male house mice Polly Campbell*,1, Jeffrey M. Good§, and Michael W. Nachman* *Department of Ecology and Evolutionary Biology, University of Arizona, Tucson, Arizona 85721 §Division of Biological Sciences, University of Montana, Missoula, Montana 59812 1 Copyright 2013. Running head: Disrupted X inactivation in hybrid male mice Keywords: Haldane’s rule, meiosis, postmeiotic sex chromatin, speciation, spermatogenesis 1Corresponding author: Department of Ecology and Evolutionary Biology, Biosciences West 333, 1041 E Lowell St., University of Arizona, Tucson, AZ 85721. E-mail: [email protected] 2 ABSTRACT In male mammals, the X and Y chromosomes are transcriptionally silenced in primary spermatocytes by meiotic sex chromosome inactivation (MSCI) and remain repressed for the duration of spermatogenesis. Here, we test the longstanding hypothesis that disrupted MSCI might contribute to the preferential sterility of heterogametic hybrid males. We studied a cross between wild-derived inbred strains of Mus musculus musculus and M. m. domesticus in which sterility is asymmetric: F1 males with a M. m. musculus mother are sterile or nearly so while F1 males with a M. m. domesticus mother are normal. In previous work, we discovered widespread over-expression of X-linked genes in the testes of sterile but not fertile F1 males. Here, we ask whether this over-expression is specifically a result of disrupted MSCI. To do this, we isolated cells from different stages of spermatogenesis and measured the expression of several genes using quantitative PCR. We found that X over-expression in sterile F1 primary spermatocytes is coincident with the onset of MSCI and persists in postmeiotic spermatids.
[Show full text]
A Graph-Theoretic Approach to Model Genomic Data and Identify Biological Modules Asscociated with Cancer Outcomes
A Graph-Theoretic Approach to Model Genomic Data and Identify Biological Modules Asscociated with Cancer Outcomes Deanna Petrochilos A dissertation presented in partial fulfillment of the requirements for the degree of Doctor of Philosophy University of Washington 2013 Reading Committee: Neil Abernethy, Chair John Gennari, Ali Shojaie Program Authorized to Offer Degree: Biomedical Informatics and Health Education UMI Number: 3588836 All rights reserved INFORMATION TO ALL USERS The quality of this reproduction is dependent upon the quality of the copy submitted. In the unlikely event that the author did not send a complete manuscript and there are missing pages, these will be noted. Also, if material had to be removed, a note will indicate the deletion. UMI 3588836 Published by ProQuest LLC (2013). Copyright in the Dissertation held by the Author. Microform Edition © ProQuest LLC. All rights reserved. This work is protected against unauthorized copying under Title 17, United States Code ProQuest LLC. 789 East Eisenhower Parkway P.O. Box 1346 Ann Arbor, MI 48106 - 1346 ©Copyright 2013 Deanna Petrochilos University of Washington Abstract Using Graph-Based Methods to Integrate and Analyze Cancer Genomic Data Deanna Petrochilos Chair of the Supervisory Committee: Assistant Professor Neil Abernethy Biomedical Informatics and Health Education Studies of the genetic basis of complex disease present statistical and methodological challenges in the discovery of reliable and high-confidence genes that reveal biological phenomena underlying the etiology of disease or gene signatures prognostic of disease outcomes. This dissertation examines the capacity of graph-theoretical methods to model and analyze genomic information and thus facilitate using prior knowledge to create a more discrete and functionally relevant feature space.
[Show full text]
Aberrant Methylation of the X-Linked Ribosomal S6 Kinase RPS6KA6 (RSK4) in Endometrial Cancers
Published OnlineFirst March 3, 2011; DOI: 10.1158/1078-0432.CCR-10-2668 Clinical Cancer Human Cancer Biology Research Aberrant Methylation of the X-Linked Ribosomal S6 Kinase RPS6KA6 (RSK4) in Endometrial Cancers Summer B. Dewdney1, BJ Rimel1, Premal H. Thaker1, Dominic M. Thompson Jr.2, Amy Schmidt2, Phyllis Huettner3, David G. Mutch1, Feng Gao4, and Paul J. Goodfellow1,2 Abstract Purpose: Effective treatments for advanced endometrial cancer are lacking. Novel therapies that target speci- fic pathways hold promise for better treatment outcomes with less toxicity. Mutation activation of the FGFR2/ RAS/ERK pathway is important in endometrial tumorigenesis. RPS6KA6 (RSK4) is a putative tumor suppres- sor gene and is a target of the ERK signaling pathway. We explored the role of RSK4 in endometrial cancer. Experimental Design: We showed that RSK4 is expressed in normal endometrial tissue and is absent or much reduced in endometrial cancer. On the basis of previous reports on methylation in other cancers, we hypothesized that the absence of RSK4 transcript is associated with epigenetic silencing rather than mutation. We determined the methylation and expression status of RSK4 in primary endometrial cancers and cell lines and the effects of treatment with a demethylating agent. The relationship between RSK4 methylation and clinicopathologic features was assessed. Results: RSK4 is frequently hypermethylated in endometrial cancer cells lines and in primary endometrial cancer compared with normal endometrial tissue. RSK4 methylation was significantly associated with tumor grade, with higher grade tumors having lower levels of methylation (P ¼ 0.03). RSK4 methylation levels were not associated with other clinical variables. We did find that RSK4 methylation was significantly correlated with expression in primary endometrial tumors and in cell lines.
[Show full text]
Deficiency of SYCP3-Related XLR3 Disrupts the Initiation of Meiotic Sex Chromosome
bioRxiv preprint doi: https://doi.org/10.1101/2021.03.30.437712; this version posted March 30, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 1 2 3 4 Deficiency of SYCP3-related XLR3 disrupts the initiation of meiotic sex chromosome 5 inactivation in mouse spermatogenesis 6 7 8 Natali Sobel Naveh1, Robert J. Foley1, Katelyn R. DeNegre1, Tristan C. Evans1, Anne 9 Czechanski2, Laura G. Reinholdt2,3, Michael J. O’Neill1,3* 10 11 12 1Department of Molecular and Cell Biology, University of Connecticut, Storrs CT 06269 13 USA 14 15 2The Jackson Laboratory, Bar Harbor ME 04609 USA 16 17 3Institute for Systems Genomics, University of Connecticut, Storrs CT 06269 USA 18 19 20 *Corresponding author 21 E-mail: [email protected] 22 bioRxiv preprint doi: https://doi.org/10.1101/2021.03.30.437712; this version posted March 30, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 1 1 Abstract 2 In mammals, the X and Y chromosomes share only small regions of homology 3 called pseudo-autosomal regions (PAR) where pairing and recombination in 4 spermatocytes can occur. Consequently, the sex chromosomes remain largely 5 unsynapsed during meiosis I and are sequestered in a nuclear compartment known as 6 the XY body where they are transcriptionally silenced in a process called meiotic sex 7 chromosome inactivation (MSCI).
[Show full text]
Single Cell Analysis Reveals X Chromosome Upregulation Is Not
bioRxiv preprint doi: https://doi.org/10.1101/2021.07.18.452817; this version posted July 19, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 1 Single cell analysis reveals X chromosome upregulation is not global and 2 primarily belongs to ancestral genes in pre-gastrulation embryos 3 Naik C H, Chandel D, and Gayen S* 4 Department of Molecular Reproduction, Development and Genetics, Indian Institute of Science, 5 Bangalore-560012, India. 6 *Correspondence: [email protected] 7 8 Abstract 9 Recent studies have provided substantial evidence supporting Ohno's hypothesis that 10 upregulation of active X chromosome genes balances the dosage of X-linked gene expression 11 relative to autosomal genes. However, the dynamics of X-chromosome upregulation (XCU) 12 during early development remain poorly Pre-gastrulation embryos E6.50 13 understood. Here, we have profiled the E6.25 E5.5 14 dynamics of XCU in different lineages of 15 female pre-gastrulation mouse embryos at 16 single cell level through allele-specific single 17 cell RNA-seq analysis. We found dynamic 18 XCU upon initiation of random X- Epiblast cells 19 chromosome inactivation (XCI) in epiblast Onset of Random X-inactivation 20 cells and cells of extraembryonic lineages, 21 which undergo imprinted XCI, also harbored 22 upregulated active-X chromosome. On the 23 other hand, the extent of XCU remains 24 controversial till date.
[Show full text]
Next Generation Mapping Reveals Novel Large Genomic Rearrangements in Prostate Cancer
www.impactjournals.com/oncotarget/ Oncotarget, 2017, Vol. 8, (No. 14), pp: 23588-23602 Research Paper Next generation mapping reveals novel large genomic rearrangements in prostate cancer Weerachai Jaratlerdsiri1,*, Eva K.F. Chan1,2,*, Desiree C. Petersen1,2,*, Claire Yang3, Peter I. Croucher2,4,5, M.S. Riana Bornman6, Palak Sheth3, Vanessa M. Hayes1,2,6,7 1Laboratory for Human Comparative and Prostate Cancer Genomics, Genomics and Epigenetics Division, Garvan Institute of Medical Research, Darlinghurst, Australia 2St Vincent’s Clinical School, University of New South Wales, Randwick, Australia 3Bionano Genomics Inc., San Diego, California, USA 4Bone Biology Division, Garvan Institute of Medical Research, Darlinghurst, Australia 5School of Biotechnology and Biomolecular Sciences, University of New South Wales, Randwick, Australia 6School of Health Systems and Public Health, University of Pretoria, Pretoria, South Africa 7Central Clinical School, University of Sydney, Camperdown, Australia *These authors contributed equally to this work Correspondence to: Vanessa M. Hayes, email: [email protected] Keywords: prostate cancer, structural genomic rearrangements, next generation mapping, next generation sequencing Received: August 15, 2016 Accepted: February 15, 2017 Published: March 01, 2017 ABSTRACT Complex genomic rearrangements are common molecular events driving prostate carcinogenesis. Clinical significance, however, has yet to be fully elucidated. Detecting the full range and subtypes of large structural variants (SVs), greater than
[Show full text]
X Chromosome Dosage Compensation and Gene Expression in the Sheep Kaleigh Flock [email protected]
University of Connecticut OpenCommons@UConn Master's Theses University of Connecticut Graduate School 8-29-2017 X Chromosome Dosage Compensation and Gene Expression in the Sheep Kaleigh Flock [email protected] Recommended Citation Flock, Kaleigh, "X Chromosome Dosage Compensation and Gene Expression in the Sheep" (2017). Master's Theses. 1144. https://opencommons.uconn.edu/gs_theses/1144 This work is brought to you for free and open access by the University of Connecticut Graduate School at OpenCommons@UConn. It has been accepted for inclusion in Master's Theses by an authorized administrator of OpenCommons@UConn. For more information, please contact [email protected]. X Chromosome Dosage Compensation and Gene Expression in the Sheep Kaleigh Flock B.S., University of Connecticut, 2014 A Thesis Submitted in Partial Fulfillment of the Requirements for the Degree of Masters of Science at the University of Connecticut 2017 i Copyright by Kaleigh Flock 2017 ii APPROVAL PAGE Masters of Science Thesis X Chromosome Dosage Compensation and Gene Expression in the Sheep Presented by Kaleigh Flock, B.S. Major Advisor___________________________________________________ Dr. Xiuchun (Cindy) Tian Associate Advisor_________________________________________________ Dr. David Magee Associate Advisor_________________________________________________ Dr. Sarah A. Reed Associate Advisor_________________________________________________ Dr. John Malone University of Connecticut 2017 iii Dedication This thesis is dedicated to my major advisor Dr. Xiuchun (Cindy) Tian, my lab mates Mingyuan Zhang and Ellie Duan, and my mother and father. This thesis would not be possible without your hard work, unwavering support, and guidance. Dr. Tian, I am so thankful for the opportunity to pursue a Master’s degree in your lab. The knowledge and technical skills that I have gained are invaluable and have opened many doors in my career as a scientist and future veterinarian.
[Show full text]
A High Density of X-Linked Genes for General Cognitive Ability
Opinion TRENDS in Genetics Vol.17 No.12 December 2001 697 entries in the OMIM database because of imprecise A high density of mapping information. Furthermore, some genes have allelic heterogeneity, leading to several different entries. This is most obvious in the case of the X-linked genes for X-chromosomal genes ATRX, L1CAM, MECP2 and PLP1. In our evaluation, we counted the different allelic forms of the same gene only once. The second general cognitive problem concerns a possible ascertainment bias; owing to the preferential expression of X-linked disorders in hemizygous males, the X chromosome ability: a run-away has become an obvious focus for mapping and identifying genes for mental disability. To avoid the first source of bias, we queried the process shaping OMIM database separately for the X chromosome and each autosome, with ‘mental retardation’ as a search term, but the search was limited to conditions with human evolution? identified genes solely. In Table 1, the total number of identified genes per chromosome, according to OMIM, is shown together with the number of identified genes Ulrich Zechner, Monika Wilda, that, when mutated, cause mental impairment. Hildegard Kehrer-Sawatzki, Walther Vogel, Indeed, the frequency of genes affecting mental performance is 3.5 times higher on the X chromosome Rainald Fundele and Horst Hameister than on autosomes. To circumvent an ascertainment bias for X-chromosomal linkage, we performed additional The incidence of mental disability is 30% higher in males than in females. We queries with search terms for several other common have examined entries in the OMIM database that are associated with mental defect phenotypes: polydactyly, cleft palate, facial disability and for several other common defects.
[Show full text]
A Resource for Exploring the Understudied Human Kinome for Research and Therapeutic
bioRxiv preprint doi: https://doi.org/10.1101/2020.04.02.022277; this version posted March 11, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. A resource for exploring the understudied human kinome for research and therapeutic opportunities Nienke Moret1,2,*, Changchang Liu1,2,*, Benjamin M. Gyori2, John A. Bachman,2, Albert Steppi2, Clemens Hug2, Rahil Taujale3, Liang-Chin Huang3, Matthew E. Berginski1,4,5, Shawn M. Gomez1,4,5, Natarajan Kannan,1,3 and Peter K. Sorger1,2,† *These authors contributed equally † Corresponding author 1The NIH Understudied Kinome Consortium 2Laboratory of Systems Pharmacology, Department of Systems Biology, Harvard Program in Therapeutic Science, Harvard Medical School, Boston, Massachusetts 02115, USA 3 Institute of Bioinformatics, University of Georgia, Athens, GA, 30602 USA 4 Department of Pharmacology, The University of North Carolina at Chapel Hill, Chapel Hill, NC 27599, USA 5 Joint Department of Biomedical Engineering at the University of North Carolina at Chapel Hill and North Carolina State University, Chapel Hill, NC 27599, USA † Peter Sorger Warren Alpert 432 200 Longwood Avenue Harvard Medical School, Boston MA 02115 [email protected] cc: [email protected] 617-432-6901 ORCID Numbers Peter K. Sorger 0000-0002-3364-1838 Nienke Moret 0000-0001-6038-6863 Changchang Liu 0000-0003-4594-4577 Benjamin M. Gyori 0000-0001-9439-5346 John A. Bachman 0000-0001-6095-2466 Albert Steppi 0000-0001-5871-6245 Shawn M.
[Show full text]
Aberrant Methylation of the X-Linked Ribosomal S6 Kinase RPS6KA6 (RSK4) in Endometrial Cancers
Author Manuscript Published OnlineFirst on March 3, 2011; DOI: 10.1158/1078-0432.CCR-10-2668 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited. Aberrant Methylation of the X-linked Ribosomal S6 Kinase RPS6KA6 (RSK4) in Endometrial Cancers Authors: Summer B. Dewdney1, BJ Rimel1, Premal H. Thaker1, Dominic M. Thompson, Jr.2, Amy Schmidt2, Phyllis Huettner3, David G. Mutch1, Feng Gao4, Paul J. Goodfellow1,2 Locations: 1Division of Gynecologic Oncology, Department of Obstetrics and Gynecology; 2Division of Endocrine and Oncologic Surgery, Department of Surgery; 3Department of Pathology and Immunology; and the4Division of Biostatistics, Washington University School of Medicine and Siteman Cancer Center, St Louis, MO Key words: Endometrial cancer, methylation, RPS6KA6, RSK4, epigenetics 1 Downloaded from clincancerres.aacrjournals.org on September 30, 2021. © 2011 American Association for Cancer Research. Author Manuscript Published OnlineFirst on March 3, 2011; DOI: 10.1158/1078-0432.CCR-10-2668 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited. ABSTRACT Purpose: Effective treatments for advanced endometrial cancer are lacking. Novel therapies that target specific pathways hold promise for better treatment outcomes with less toxicity. Mutation activation of the FGFR2/RAS/ERK pathway is important in endometrial tumoregenesis. RPS6KA6 (Rsk4) is a putative tumor suppressor gene and is a target of the ERK signaling pathway. We explored the role of RSK4 in endometrial cancer. Experimental design: We showed that RSK4 is expressed in normal endometrial tissue and is absent or much reduced in endometrial cancer. Based on previously reports on methylation in other cancers we hypothesized that the absence of RSK4 transcript is associated with epigenetic silencing rather than mutation.
[Show full text]
Genomic and Transcriptomic Characterization of the Human Glioblastoma Cell Line AHOL1
Brazilian Journal of Medical and Biological Research (2021) 54(3): e9571, http://dx.doi.org/10.1590/1414-431X20209571 ISSN 1414-431X Research Article 1/12 Genomic and transcriptomic characterization of the human glioblastoma cell line AHOL1 W.A.S. Ferreira1 00 , C.K.N. Amorim1 00 , R.R. Burbano2,3,4 00 , R.A.R. Villacis5 00 , F.A. Marchi6 00 , T.S. Medina6 00 , M.M.C. de Lima7 00 , and E.H.C. de Oliveira1,8 00 1Laboratório de Cultura de Tecidos e Citogenética, SAMAM, Instituto Evandro Chagas, Ananindeua, PA, Brasil 2Laboratório de Citogenética Humana, Instituto de Ciências Biológicas, Universidade Federal do Pará, Belém, PA, Brasil 3Núcleo de Pesquisas em Oncologia, Hospital Universitário João de Barros Barreto, Belém, PA, Brasil 4Laboratório de Biologia Molecular, Hospital Ophir Loyola, Belém, PA, Brasil 5Departamento de Genética e Morfologia, Instituto de Ciências Biológicas, Universidade de Brasília, Brasília, DF, Brasil 6Centro Internacional de Pesquisa, A.C. Camargo Cancer Center, São Paulo, SP, Brasil 7Instituto de Ciências Biológicas, Faculdade de Biomedicina, Universidade Federal do Pará, Belém, PA, Brasil 8Instituto de Ciências Exatas e Naturais, Faculdade de Ciências Naturais, Universidade Federal do Pará, Belém, PA, Brasil Abstract Cancer cell lines are widely used as in vitro models of tumorigenesis, facilitating fundamental discoveries in cancer biology and translational medicine. Currently, there are few options for glioblastoma (GBM) treatment and limited in vitro models with accurate genomic and transcriptomic characterization. Here, a detailed characterization of a new GBM cell line, namely AHOL1, was conducted in order to fully characterize its molecular composition based on its karyotype, copy number alteration (CNA), and transcriptome proﬁling, followed by the validation of key elements associated with GBM tumorigenesis.
[Show full text]