Anti-RPS6KA6 monoclonal antibody, clone 9I6 (DMABT-H12544) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Product Overview Mouse Anti-RPS6KA6 Monoclonal Antibody Target RPS6KA6 Immunogen RPS6KA6 (NP_055311.1, 636 a.a. ~ 745 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype IgG2a Source/Host Mouse Species Reactivity Human, Rat Clone 9I6 Conjugate Unconjugated Applications WB, IHC, ELISA Sequence Similarities RIGNGKFSLSGGNWDNISDGAKDLLSHMLHMDPHQRYTAEQILKHSWITHRDQLPNDQPKRND VSHVVKGAMVAT YSALTHKTFQPVLEPVAASSLAQRRSMKKRTSTGL Size 1 ea Buffer In 1x PBS, pH 7.2 Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION Gene Name RPS6KA6 ribosomal protein S6 kinase, 90kDa, polypeptide 6 [ Homo sapiens ] Official Symbol RPS6KA6 Synonyms RPS6KA6; ribosomal protein S6 kinase, 90kDa, polypeptide 6; ribosomal protein S6 kinase, 90kD, polypeptide 6; ribosomal protein S6 kinase alpha-6; RSK4; RSK-4; p90RSK6; p90-RSK 6; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved S6K-alpha 6; S6K-alpha-6; ribosomal S6 kinase 4;00kDa ribosomal protein S6 kinase 6; PP90RSK4; Entrez Gene ID 27330 Protein Refseq NP_055311 UniProt ID Q9UK32 Chromosome Location Xq21.1 Pathway Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; Axon guidance, organism-specific biosystem; CREB phosphorylation through the activation of Ras, organism-specific biosystem; Cytoplasmic Ribosomal Proteins, organism- specific biosystem; Developmental Biology, organism-specific biosystem; Insulin Signaling, organism-specific biosystem; L1CAM interactions, organism-specific biosystem. Function ATP binding; magnesium ion binding; nucleotide binding; protein kinase activity; protein serine/threonine kinase activity; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.