DOCSLIB.ORG

Session Report

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Session Report EMECS12 Conference 12th International Conference on the Environmental Management of Enclosed Coastal Seas - Cooperative stewardship for integrated management toward resilient coastal seas – Special Session: Satoumi and ICM Session Time & Date: 13:30 – 16:30, 5 November, 2018 Venue: Oriental Palm 2, Jomtien Palm Beach Hotel, Pattaya, Thailand Session Report International EMECS Center Preface “Special Session : Satoumi and ICM Session” was held in EMECS 12 Conference (12th International Conference on the Environmental Management of Enclosed Coastal Seas) to discuss “Sustainable Integrated Coastal Management” with various experts from around the world. In Japan, heavy use of urban enclosed coastal seas caused serious deterioration of environment in 1970s. Since then, legislative and infrastructural measures were implemented such as enactment of the water pollution control act and construction of sewage treatment facilities. Nevertheless, fish catch and biodiversity in the area have not been recovered even after water quality was improved. A new model for the management of enclosed coastal seas is required. Satoumi is a management concept for balancing use and conservation to maximize productivity and biodiversity in coastal area. In 2014, Government of Japan started a new project “Development of Coastal Management Method to Realize the Sustainable Coastal Sea (Environment Research and Technology Development Fund of the Environmental Restoration and Conservation Agency of Japan S-13 project)”, and this project has been implemented until March, 2019. This project involves a comprehensive examination of natural and human activity in coastal seas and land areas that constitute their hinterlands, in order to determine how these areas should be changed from their present state to an appropriate status in terms of material circulation and ecotones. Policy proposals will be made on the following theme: (1) Seto Inland Sea (Enclosed coastal sea) (2) Sanriku Coast (Open-character coastal sea) (3) Japan Sea (International enclosed coastal sea) (4) Discussions regarding the societal and humanities aspects (5) Integrated numerical models for coastal sea management In this session, we presented the research results of this project we have had so far and discussed under the theme of “Satoumi and ICM” around the world. This session was supported by the Environment Research and Technology Development Fund (S-13) of the Environmental Restoration and Conservation Agency of Japan. CONTENTS Program ・・・・・・ 1 Summary ・・・・・・ 2 Opening Remarks ・・・・・・ 4 Abstracts ・・・・・・ 5 Presentations ・・・・・ 14 1 Tetsuo Yanagi: Development of Coastal Management Method to ・・・・・ 14 Realize the Sustainable Coastal Sea (Japan) 2 Wataru Nishijima: Management of the ecosystem in the Seto Inland ・・・・・ 21 Sea (Theme 1: Seto Inland Sea) (Japan) Teruhisa Komatsu: Satoumi practice and sciences support 3 sustainable use of a rias-type bay in southern Sanriku Coast after the ・・・・・ 25 huge tsunami 2011 (Theme 2: Sanriku Coast) (Japan) Takafumi Yoshida: Land-ocean integrated management of Toyama 4 Bay in the international semi enclosed sea, Japan Sea (Theme 3: ・・・・・ 31 Japan Sea) (Japan) 5 Robert M. Summers: Restoration framework for Guanabara bay, Rio ・・・・・ 35 de Janeiro Brazil (USA) 6 Takuro Uehara: An ecosystem services-based assessment for Sato- ・・・・・ 48 umi (Theme 4: Social & Human Science)(Japan) 7 Suhendar I. Sachoemar: Satoumi activities in Indonesia (Indonesia) ・・・・・ 53 8 Satoshi Yamamoto: The environmental water management in the ・・・・・ 61 enclosed coastal seas in Japan (Japan) 9 R.W. Carter: Does anyone care about declining water and biotic ・・・・・ 67 quality in the eastern Andaman Sea? (Australia) EMECS12 Conference Schedule ・・・・・ 70 EMECS12 Conference Program ・・・・・ 71 Program Chair : Tetsuo Yanagi (International EMECS Center) Co-chair : Patama Singharuk(Chulalongkon Univesity) 13:30 – 13:35 Opening Remarks Takanori Konishi: Head of delegation, Hyogo Prefectural Assembly, Japan Part 1 (13:30 -14:45) 1. 13:35 – 14:00 <Invited paper> Tetsuo Yanagi: Development of Coastal Management Method to Realize the Sustainable Coastal Sea (Japan) 2. 14:00 – 14:15 Wataru Nishijima: Management of the ecosystem in the Seto Inland Sea (Theme 1: Seto Inland Sea) (Japan) 3. 14:15 – 14:30 Teruhisa Komatsu: Satoumi practice and sciences support sustainable use of a rias-type bay in southern Sanriku Coast after the huge tsunami 2011 (Theme 2: Sanriku Coast) (Japan) 4. 14:30 – 14:45 Takafumi Yoshida: Land-ocean integrated management of Toyama Bay in the international semi enclosed sea, Japan Sea (Theme 3: Japan Sea) (Japan) Coffee-break (14:45 – 15:00) Part 2 (15:00-16:30) 5. 15:00 – 15:30 <Invited paper> Robert M. Summers: Restoration framework for Guanabara bay, Rio de Janeiro Brazil (USA) 6. 15:30 – 15:45 Takuro Uehara: An ecosystem services-based assessment for Sato-umi (Theme 4: Social & Human Science)(Japan) 7. 15:45 – 16:00 Suhendar I. Sachoemar: Satoumi activities in Indonesia (Indonesia) 8. 16:00 – 16:15 Satoshi Yamamoto: The environmental water management in the enclosed coastal seas in Japan (Japan) 9. 16:15 – 16:30 R.W. Carter: Does anyone care about declining water and biotic quality in the eastern Andaman Sea? (Australia) 1 Summary This session demonstrated that the Satoumi Concept is one that is steadily increasing in visibility not only in Japan but also at international conferences in Europe, the United States and other parts of Asia. The Special Session featured reports on various activities to preserve marine environments, presented by specialists from both Japan and various other countries including Indonesia. The session attracted an overflow crowd of attendees, with some in the standing room area. There were intense discussions and a spirited exchange of views, so much so that the session actually went overtime. It was decided that there should be further efforts to promote Satoumi internationally as an effective means for achieving Integrated Coastal Management (ICM). “12th International Conference on the Environmental Management of Enclosed Coastal Seas (EMECS 12)” included a special session entitled “Satoumi and ICM Session”. The special session was held from 1:30 p.m. to 4:30 p.m. on November 5, 2018 at the Jomtien Palm Beach Hotel in Pattaya, Thailand. At the opening of the session, Takanori Konishi, Vice-Chair of the Hyogo Prefectural Assembly, took the podium and greeted the attendees. He said that Seto Inland Sea (Japan), which has managed to overcome the extreme pollution of its past, is now suffering from declining fishing catches. He said that scientists, government and local residents were cooperating in the effort to restore the beautiful and abundant Seto Inland Sea, and said he hoped that today’ s session would play a role in restoring its abundance. In the first half of the session , by way of introducing the Satoumi concept, Principal Researcher Yanagi (International EMECS Center) presented an overview of the S13 “Development of Coastal Management Method to Realize the Sustainable Coastal Sea” Project of the Ministry of the Environment, and discussed the approach to putting together a final report. Next, Professor Wataru Nishijima (Hiroshima University) reported on the results of research into S-13 Topic 1. He said that the revitalization of Zostera beds in coastal ocean areas was the most effective way of managing nutrient salt concentrations in Hiroshima Bay. Next, Professor Teruhisa Komatsu (Yokohama College of Commerce) reported on the results of research into S-13 Topic 2. He said that, at Shizugawa Bay in Miyagi Prefecture, which is working to recover from the damage caused by the “Huge Tsunami in 2011”, fishermen, the government and scientists had worked together to 2 devise the ideal cultivation technique for use in the bay. Finally, Chief Researcher Takafumi Yoshida( Northwest Pacific Region Environmental Cooperation Center (NPEC)) reported on the results of research into S-13 Topic 3. He said that environmental management in the Sea of Japan would require management on three levels: the entire area, the medial zone of the Tsushima Current, and the nearby ocean areas. As an example of management of nearby ocean areas, he said that, in Toyama Bay, groundwater management efforts designed to accommodate the effects of climate change would be important. In the second half of the session, Robert M. Summers (U. S.) reported on environmental improvement policies in Guanabara Bay, Brazil and the results of those policies. Professor Takuro Uehara(Ritsumeikan University) reported on research into S-13 Topic 4. He said that, in order to achieve sustainable coastal ocean areas, it was effective to establish activities to evaluate sustainability on three levels, based on integrated sustainability indicators. Suhendar Sachoemar (Indonesia) reported on the successful conclusion of combined aqaculture on the Karawang Coast in Indonesia and off the coast of Banting, based on the Satoumi Concept. Satoshi Yamamoto(Director of the Office for Environment Management of Enclosed Coastal Seas, Ministry of the Environment,Japan) reported that Japan’s policy of Management Pollutant Load System was effective and was improving water quality in various enclosed coastal seas in Japan. Finally, R. W. Carter of Australia spoke about the deterioration of water quality in the eastern part of the Andaman Sea, and raised the question of what measures would be effective and which entity in the coastal ocean area should take the lead in implementing those measures. There was spirited
Load more

Recommended publications
  • Results of Cultivation of Japanese Kelp (Saccharina Japonica ) in Primorsky Krai, Russia
    International Journal of Nutrition and Food Sciences 2016; 5(3): 145-159 http://www.sciencepublishinggroup.com/j/ijnfs doi: 10.11648/j.ijnfs.20160503.11 ISSN: 2327-2694 (Print); ISSN: 2327-2716 (Online) Results of Cultivation of Japanese Kelp (Saccharina japonica ) in Primorsky Krai, Russia Delik D. Gabaev, Serge M. Dimitriev Academy of Sciences, A. V. Zhirmunsky Institute of Marine Biology, Far Eastern Branch, Russian Email address: [email protected] (D. D. Gabaev) To cite this article: Delik D. Gabaev, Serge M. Dimitriev. Results of Cultivation of Japanese Kelp (Saccharina japonica ) in Primorsky Krai, Russia. International Journal of Nutrition and Food Sciences. Vol. 5, No. 3, 2016, pp. 145-159. doi: 10.11648/j.ijnfs.20160503.11 Received : January 14, 2016; Accepted : March 25, 2016; Published : April 12, 2016 Abstract: Animals and plants, living near human settlements in the three climatic zones, accumulate substances that allow them to resist extreme environmental factors. By consuming these plants and animals, people strengthen the immune system that also facilitates their existence in harsh conditions. Many of the world known species appreciated for their medicinal properties inhabit Primorsky Krai, which is located in three climatic zones. On land, these are plants of the family of Araliaceae, including the well-known ginseng; in the sea, the Japanese sea cucumber and brown algae, including the Japanese kelp Saccharina (=Laminaria) japonica . This publication provides the results of cultivation of commercially valuable Japanese kelp by several technologies at sea-based farms in Russia. Keywords: Three Climatic Zones, Health Food, Forced Cultivation, Japanese Kelp, Saccharina (=Laminaria) japonica which was edited by Emperor Daigo (897-930) in Japan at 1.
    [Show full text]
  • A Survey of Epiphytic Organisms in Cultured Kelp Saccharina Japonica
    Kim et al. Fisheries and Aquatic Sciences (2017) 20:1 DOI 10.1186/s41240-017-0046-z RESEARCH ARTICLE Open Access A survey of epiphytic organisms in cultured kelp Saccharina japonica in Korea Jong-Oh Kim1, Wi-Sik Kim1, Ha-Na Jeong1, Sung-Je Choi2, Jung-Soo Seo3, Myoung-Ae Park3 and Myung-Joo Oh1* Abstract A survey was conducted to investigate the presence of epiphytic organisms in four kelp Saccharina japonica farms in the coastal area of Korea from 2014 to 2015. Of 740 kelp samples that were taken, 208 exhibited six kinds of epiphytic organisms, including hydroid (detection rate: 11.6%), bryozoan (6.4%), polychaete (3.4%), algae (3.2%), caprellid (3%), and oyster (0.5%). The infestation rate for hydroid, bryozoan, and polychaete was significantly higher in the Wando farm, Busan farm, and Pohang farm, respectively. Epiphytic organisms were generally observed during May to September and not January to April, indicating that their infestation was significantly higher when the water had a higher temperature. The histopathogical examination revealed that hydroid and bryozoan organisms were attached on the cuticula of the thallus while some algae were attached on the cuticula of the thallus or had penetrated the epidermis. These results indicate that hydroid and bryozoan were the most predominant epiphytic organisms in Korean kelp farms, even though the infested thallus had not been broken. Keywords: Epiphytic organisms, Bryozoan, Hydroid, Kelp, Saccharina japonica Background epiphytic organisms (Gong et al., 2010; Park and Hwang, Within the last 30 years, seaweed cultivation has 2012). An infestation is characterized by the appearance attained large-scale production levels and has become a of numerous colonies on the thallus of the kelp, and major industry in China, Korea, and Japan.
    [Show full text]
  • Molecular Interactions Between the Kelp Saccharina Latissima and Algal Endophytes Miriam Bernard
    Molecular interactions between the kelp saccharina latissima and algal endophytes Miriam Bernard To cite this version: Miriam Bernard. Molecular interactions between the kelp saccharina latissima and algal endophytes. Symbiosis. Sorbonne Université, 2018. English. NNT : 2018SORUS105. tel-02555205 HAL Id: tel-02555205 https://tel.archives-ouvertes.fr/tel-02555205 Submitted on 27 Apr 2020 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Sorbonne Université Ecole doctorale Sciences de la Nature et de l’Homme (ED 227) Laboratoire de Biologie Intégrative des Modèles Marins UMR 8227 Equipe Biologie des algues et interactions avec l’environnement Molecular interactions between the kelp Saccharina latissima and algal endophytes Par Miriam Bernard Thèse de doctorat de Biologie Marine Dirigée par Catherine Leblanc et Akira F. Peters Présentée et soutenue publiquement le 07/09/2018 Devant un jury composé de : Dr. Florian Weinberger Chercheur GEOMAR Kiel Rapporteur Dr. Sigrid Neuhauser Chercheur Univ. Innsbruck Rapportrice Pr. Soizic Prado Professeur MNHN Examinatrice Pr. Christophe Destombe Professeur Sorbonne Université Représentant UPMC Dr. Catherine Leblanc Directrice de Recherche Directrice de thèse Dr. Akira F. Peters Chercheur Bezhin Rosko Directeur de thèse Acknowledgements First of all, I would like to thank my supervisors Catherine Leblanc and Akira Peters.
    [Show full text]
  • A Review of Reported Seaweed Diseases and Pests in Aquaculture
    UHI Research Database pdf download summary A review of reported seaweed diseases and pests in aquaculture in Asia Ward, Georgia; Faisan, Joseph; Cottier-Cook, Elizabeth; Gachon, Claire; Hurtado, Anicia; Lim, Phaik-Eem; Matoju, Ivy; Msuya, Flower; Bass, David; Brodie, Juliet Published in: Journal of the World Aquaculture Society Publication date: 2019 The re-use license for this item is: CC BY The Document Version you have downloaded here is: Publisher's PDF, also known as Version of record The final published version is available direct from the publisher website at: 10.1111/jwas.12649 Link to author version on UHI Research Database Citation for published version (APA): Ward, G., Faisan, J., Cottier-Cook, E., Gachon, C., Hurtado, A., Lim, P-E., Matoju, I., Msuya, F., Bass, D., & Brodie, J. (2019). A review of reported seaweed diseases and pests in aquaculture in Asia. Journal of the World Aquaculture Society, [12649]. https://doi.org/10.1111/jwas.12649 General rights Copyright and moral rights for the publications made accessible in the UHI Research Database are retained by the authors and/or other copyright owners and it is a condition of accessing publications that users recognise and abide by the legal requirements associated with these rights: 1) Users may download and print one copy of any publication from the UHI Research Database for the purpose of private study or research. 2) You may not further distribute the material or use it for any profit-making activity or commercial gain 3) You may freely distribute the URL identifying the publication in the UHI Research Database Take down policy If you believe that this document breaches copyright please contact us at [email protected] providing details; we will remove access to the work immediately and investigate your claim.
    [Show full text]
  • Assessment of Major Pressures on Marine Biodiversity in the NOWPAP Region
    NOWPAP CEARAC Northwest Pacific Action Plan Special Monitoring and Coastal Environmental Assessment Regional Activity Centre 5-5 Ushijimashin-machi, Toyama City, Toyama 930-0856, Japan Tel: +81-76-445-1571, Fax: +81-76-445-1581 Email: [email protected] Website: http://cearac.nowpap.org/ Assessment of major pressures on marine biodiversity in the NOWPAP region NOWPAP CEARAC 2018 Published in 2018 By the NOWPAP Special Monitoring and Coastal Environmental Assessment Regional Activity Centre (NOWPAP CEARAC) Established at the Northwest Pacific Region Environmental Cooperation Center 5-5 Ushijimashin-machi, Toyama City, Toyama 930-0856 E-mail: [email protected] Website: http://cearac.nowpap.org/ Contributed Authors: Dr. Bei HUANG (Marine Biological Monitoring Division, Zhejiang Provincial Zhoushan Marine Ecological Environmental Monitoring Station, China), Dr. Yasuwo FUKUYO (Emeritus professor of University of Tokyo, Japan), Dr. Young Nam KIM (Korea Marine Environment Management Corp., Korea), Dr. Jaehoon NOH (Korea Institute of Ocean Science and Technology, Korea), Dr. Tatiana ORLOVA (Laboratory of Marine Microbiota, National Scientific Center of Marine Biology, Far East Branch of Russian Academy of Science) and Dr. Takafumi YOSHIDA (Secretariat of the NOWPAP CEARAC) Copyright Ⓒ NOWPAP CEARAC 2018 For bibliographical purposes, this document may be cited as: NOWPAP CEARAC 2018 Assessment of major pressures on marine biodiversity in the NOWPAP region 1 Contents 3 Acknowlegement 4 Executive Summary 6 Introduction 10 Assessment data and method 21 Status of major pressures inthe NOWPAPregion 55 Conclusion and recommendation 58 Reference 2 Acknowledgement CEARAC Secretariat would like to acknowledge the contributions of Dr. Bei HUANG from Marine Biological Monitoring Division, Zhejiang Provincial Zhoushan Marine Ecological Environmental Monitoring Station, Dr.
    [Show full text]
  • The Evolution of Silicon Transport in Eukaryotes Article Open Access
    The Evolution of Silicon Transport in Eukaryotes Alan O. Marron,*1,2 Sarah Ratcliffe,3 Glen L. Wheeler,4 Raymond E. Goldstein,1 Nicole King,5 Fabrice Not,6,7 Colomban de Vargas,6,7 and Daniel J. Richter5,6,7 1Department of Applied Mathematics and Theoretical Physics, Centre for Mathematical Sciences, University of Cambridge, Cambridge, United Kingdom 2Department of Zoology, University of Cambridge, Cambridge, United Kingdom 3School of Biochemistry, Biomedical Sciences Building, University of Bristol, University Walk, Bristol, United Kingdom 4Marine Biological Association, The Laboratory, Citadel Hill, Plymouth, Devon, United Kingdom 5Howard Hughes Medical Institute and Department of Molecular and Cell Biology, University of California, Berkeley, CA 6CNRS, UMR 7144, Station Biologique de Roscoff, Place Georges Teissier, Roscoff, France 7Sorbonne Universite´s, Universite´ Pierre et Marie Curie (UPMC) Paris 06, UMR 7144, Station Biologique de Roscoff, Place Georges Teissier, Roscoff, France *Corresponding author: E-mail: [email protected]. Associate editor: Lars S. Jermiin Abstract Biosilicification (the formation of biological structures from silica) occurs in diverse eukaryotic lineages, plays a major role in global biogeochemical cycles, and has significant biotechnological applications. Silicon (Si) uptake is crucial for biosilicification, yet the evolutionary history of the transporters involved remains poorly known. Recent evidence suggests that the SIT family of Si transporters, initially identified in diatoms, may be widely distributed, with an extended family of related transporters (SIT-Ls) present in some nonsilicified organisms. Here, we identify SITs and SIT-Ls in a range of eukaryotes, including major silicified lineages (radiolarians and chrysophytes) and also bacterial SIT-Ls. Our evidence suggests that the symmetrical 10-transmembrane-domain SIT structure has independently evolved multiple times via duplication and fusion of 5-transmembrane-domain SIT-Ls.
    [Show full text]
  • A New Indicator of 15N Signature for Detecting Nutrient Supply Effects To
    Algal Resources (2016) 9：1-13 A new indicator of 15N signature for detecting nutrient supply effects to Saccharina japonica var. religiosa Takanori KURIBAYASHI1,2*, Shoichi AKAIKE3 and Shigeru MONTANI2,4 Abstract : A possible new indicator of 15N for detecting nutrient supply effects to Saccharina japonica var. religiosa was investigated. Nutrient supply was examined by 15 15 adding (NH4)2SO4 fertilizer which shows lower Nthan N-NO3 of natural seawater on the southwest coast of Hokkaido, Japan, and the fertilizing amounts and periods were adjusted each year (2009-2013). The 15NinS. japonica var. religiosa and other species of 15 seaweeds before fertilization were close to N-NO3 in Tsushima Warm Current. After fertilization, S. japonica var. religiosa growth promotion and algal biomass enhancement were observed at the fertilizing point compared with the natural site. The 15Ninalgal tissue were significantly depleted at the fertilizing point, and approached levels before fertilization with distance from the fertilizing point. The distance from the fertilizing point at which the 15N in algal tissue were almost the same level as before fertilization dif- fered among years. These results indicate that the nutrient supply was related to fertilizing amounts, periods, and distance from the fertilizing point affected the algal uptake, and were reflected in the 15N values of algal tissue. We propose the applicability of 15N signature as a new indicator for detecting nutrient supply effects to S. japonica var. religiosa. Keywords : nutrient supply effects, indicator, oligotrophic sea, Saccharina japonica var. religiosa, 15N Introduction Fujiwara 2011; Tada et al. 2014), and this de- crease is causing damage such as the fishery Nutrients in seawater via“Bottom-up effects” production, the discoloration of the cultured often limit kelp production, which is funda- Porphyra (Hori et al.
    [Show full text]
  • New Diets with Potential for Enhancement of Juvenile Bivalve Seed Production and Culture Techniques
    水研機構研報，第50号，149－158，令和３年 Bull. Jap. Fish. Res. Edu. Agen. No. 50，149－158，2021 149 New diets with potential for enhancement of juvenile bivalve seed production and culture techniques Yasuhiro YAMASAKI＊ Abstract: Environmental changes are now having a negative impact on a number of aquatic organisms. In the decades after the mid-1980s, annual catch of bivalves such as the Manila clam (Ruditapes philippinarum) continues to decrease drastically in the coastal waters of Japan, and several causative factors have been reported. To conserve the bivalve resources, the promotion of efficiency and stabilization of seed and juvenile bivalve production is needed in addition to the promotion of marine ecosystem and habitat recovery. Under these circumstances, a persistent problem is insufficient food supply for juvenile bivalves because of the difficulty in stable production of diet microalgae at low cost and a deficiency of microalgae that possesses all the necessary dietary requirements. Thus, there is a compelling need for the development of dietary- supplements and/or new species of diet microalgae that contain the essential nutritional properties, and of alternative feeds to replace live microalgal diets. In this mini-review, new diet microalgae, a dietary-supplement, and original feeds using microencapsulation, enzymatic decomposition and fermentation technology with potential for the enhancement of juvenile bivalve seeding production and culture techniques are introduced. Key words: alginate hydrolysate, Eutreptiella eupharyngea, lipid-walled
    [Show full text]
  • The Global Status of Seaweed Production, Trade and Utilization
    GLOBEFISH RESEARCH PROGRAMME The global status of seaweed production, trade and utilization Volume 124 FAO GLOBEFISH RESEARCH PROGRAMME VOL. 124 The global status of seaweed production, trade and utilization by Fatima Ferdouse Susan Løvstad Holdt Rohan Smith Pedro Murúa Zhengyong Yang FAO Consultants Products, Trade and Marketing Branch Fisheries and Aquaculture Policy and Resources Division Rome, Italy FOOD AND AGRICULTURE ORGANIZATION OF THE UNITED NATIONS Rome, 2018 5HTXLUHGFLWDWLRQ )$2 7KHJOREDOVWDWXVRIVHDZHHGSURGXFWLRQWUDGHDQGXWLOL]DWLRQ *OREHILVK5HVHDUFK3URJUDPPH9ROXPH 5RPHSS /LFHQFH&&%<1&6$,*2 7KHGHVLJQDWLRQVHPSOR\HGDQGWKHSUHVHQWDWLRQRIPDWHULDOLQWKLVLQIRUPDWLRQSURGXFWGRQRWLPSO\WKHH[SUHVVLRQRIDQ\RSLQLRQZKDWVRHYHU RQWKHSDUWRIWKH)RRGDQG$JULFXOWXUH2UJDQL]DWLRQRIWKH8QLWHG1DWLRQV )$2 FRQFHUQLQJWKHOHJDORUGHYHORSPHQWVWDWXVRIDQ\FRXQWU\ WHUULWRU\FLW\RUDUHDRURILWVDXWKRULWLHVRUFRQFHUQLQJWKHGHOLPLWDWLRQRILWVIURQWLHUVRUERXQGDULHV7KHPHQWLRQRI VSHFLILFFRPSDQLHVRU SURGXFWVRIPDQXIDFWXUHUVZKHWKHURUQRWWKHVHKDYHEHHQSDWHQWHGGRHVQRWLPSO\WKDWWKHVHKDYHEHHQHQGRUVHGRUUHFRPPHQGHGE\ )$2LQSUHIHUHQFHWRRWKHUVRIDVLPLODUQDWXUHWKDWDUHQRWPHQWLRQHG 7KHYLHZVH[SUHVVHGLQWKLVLQIRUPDWLRQSURGXFWDUHWKRVHRIWKHDXWKRU V DQGGRQRWQHFHVVDULO\UHIOHFWWKHYLHZVRUSROLFLHVRI)$2 ,6%1 )$2 6RPHULJKWVUHVHUYHG7KLVZRUNLV PDGH DYDLODEOHXQGHUWKH&UHDWLYH&RPPRQV$WWULEXWLRQ1RQ&RPPHUFLDO6KDUH$OLNH ,*2OLFHQFH && %<1&6$ ,*2KWWSVFUHDWLYHFRPPRQVRUJOLFHQVHVE\QFVDLJR 8QGHUWKHWHUPVRIWKLVOLFHQFH WKLVZRUNPD\EHFRSLHGUHGLVWULEXWHG DQGDGDSWHG IRUQRQFRPPHUFLDOSXUSRVHVSURYLGHGWKDWWKHZRUNLV DSSURSULDWHO\FLWHG,QDQ\XVHRIWKLVZRUNWKHUHVKRXOGEHQRVXJJHVWLRQWKDW)$2
    [Show full text]
  • Safeguarding the Future of the Global Seaweed Aquaculture Industry Elizabeth J
    United Nations University Institute for Water, Environment and Health (UNU-INWEH) & Scottish Association for Marine Science (SAMS) POLICYBRIEF Safeguarding the future of the global seaweed aquaculture industry Elizabeth J. Cottier-Cook1, Nidhi Nagabhatla2, Yacine Badis1, Marnie L. Campbell3, Thierry Chopin4, Weiping Dai5, Jianguang Fang6, Peimin He7, Chad L. Hewitt3, Gwang Hoon Kim8, Yuanzi Huo7, Zengjie Jiang6, Gert Kema9, Xinshu Li10, Feng Liu11,12, Hongmei Liu13, Yuanyuan Liu7, Qinqin Lu14, Qijun Luo15, Yuze Mao6, Flower E. Msuya16, Céline Rebours17, Hui Shen14, Grant D. Stentiford18, Charles Yarish19, Hailong Wu7, Xinming Yang20, Jihong Zhang6, Yongdong Zhou21, Claire M. M. Gachon1 Corresponding author: [email protected] Highlights 1. Global aquaculture production continues to valuable lessons can be drawn from the increase, whilst capture fisheries stagnate. major seaweed-producing nations and other Many wild fisheries have been aqua- and agriculture sectors. overexploited. Cultivation, if managed sustainably, is a viable alternative. 4. Improving biosecurity, disease prevention and detection measures are critical, together 2. The seaweed industry is undergoing a rapid with establishing policies and institutions. global expansion and currently accounts for This will provide incentives and steer the ~49% of the total mariculture production. long-term economic and environmental Unabated exponential growth in the last development of a sustainable seaweed 50 years has meant that the value of the aquaculture industry. industry reached US$6.4 billion in 2014, providing jobs, predominantly in developing 5. This policy brief highlights key issues that and emerging economies. need to be addressed to create longterm sustainability of this emerging global 3. There is increasing need to address new industry, as it prepares itself for playing an challenges imposed by trade and market important role in the ‘blue’ ocean economy demand.
    [Show full text]
  • Saccharina Latissima Cultivated in Northern Norway: Reduction of Potentially Toxic Elements During Processing in Relation to Cultivation Depth
    foods Article Saccharina latissima Cultivated in Northern Norway: Reduction of Potentially Toxic Elements during Processing in Relation to Cultivation Depth Marthe Jordbrekk Blikra 1,* , Xinxin Wang 2, Philip James 2 and Dagbjørn Skipnes 1 1 Department of Processing Technology, Seafood Division, Nofima AS, P.O. Box 8034, NO-4068 Stavanger, Norway; dagbjorn.skipnes@nofima.no 2 Department of Aquaculture Production, Aquaculture Division, Nofima AS, P.O. Box 6122, NO-9291 Tromsø, Norway; xinxin.wang@nofima.no (X.W.); philip.james@nofima.no (P.J.) * Correspondence: marthe.blikra@nofima.no Abstract: There is an increasing interest in the use of Saccharina latissima (sugar kelp) as food, but the high iodine content in raw sugar kelp limits the daily recommended intake to relatively low levels. Processing strategies for iodine reduction are therefore needed. Boiling may reduce the iodine content effectively, but not predictably, since reductions from 38–94% have been reported. Thus, more information on which factors affect the reduction of iodine are needed. In this paper, sugar kelp cultivated at different depths were rinsed and boiled, to assess the effect of cultivation depth on the removal efficacy of potentially toxic elements (PTEs), especially iodine, cadmium, and arsenic, during processing. Raw kelp cultivated at 9 m contained significantly more iodine than kelp cultivated at 1 m, but the difference disappeared after processing. Furthermore, the content of cadmium and arsenic was not significantly affected by cultivation depth. The average reduction during rinsing Citation: Jordbrekk Blikra, M.; Wang, and boiling was 85% for iodine and 43% for arsenic, but no significant amount of cadmium, lead, X.; James, P.; Skipnes, D.
    [Show full text]
  • Genetic and Epigenetic Control of Life Cycle Transitions in the Brown Alga Ectocarpus Sp
    Genetic and epigenetic control of life cycle transitions in the brown alga Ectocarpus sp. Simon Bourdareau To cite this version: Simon Bourdareau. Genetic and epigenetic control of life cycle transitions in the brown alga Ec- tocarpus sp.. Development Biology. Sorbonne Université, 2018. English. NNT : 2018SORUS028. tel-02111040 HAL Id: tel-02111040 https://tel.archives-ouvertes.fr/tel-02111040 Submitted on 25 Apr 2019 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Sorbonne Université Ecole Doctorale 515 Complexité du Vivant UMR 8227 CNRS – Sorbonne Université Laboratoire de Biologie Intégrative des Modèles Marins Equipe Génétique des Algues Contrôle génétique et épigénétique des transitions du cycle de vie chez l’algue brune Ectocarpus sp. Genetic and epigenetic control of life cycle transitions in the brown alga Ectocarpus sp. Par Simon Bourdareau Thèse de doctorat de Biologie du développement Dirigée par J. Mark Cock et Susana M. Coelho Présentée et soutenue publiquement le 27 Mars 2018 Devant un jury composé de : Dr Gareth Bloomfield, Rapporteur Medical Research Council, UK Dr Célia Baroux, Rapportrice University of Zurich, Switzerland Pr Christophe Destombe, Examinateur Sorbonne Université - CNRS Dr Akira F. Peters, Examinateur Chercheur Indépendant Dr Frédérique Peronnet, Invitée Sorbonne Université - CNRS Dr J.
    [Show full text]