DOCSLIB.ORG

Role of the AAA Protease Yme1 in Folding of Proteins in the Mitochondrial Intermembrane Space

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Role of the AAA Protease Yme1 in Folding of Proteins in the Mitochondrial Intermembrane Space Role of the AAA protease Yme1 in folding of proteins in the mitochondrial intermembrane space Bernadette Schreiner München 2012 Role of the AAA protease Yme1 in folding of proteins in the mitochondrial intermembrane space Dissertation zur Erlangung des Doktorgrades der Fakultät für Biologie der Ludwig-Maximilians-Universität München vorgelegt von Bernadette Schreiner aus Limburgerhof München 2012 Eidesstattliche Erklärung Ich versichere hiermit an Eides statt, dass die vorgelegte Dissertation von mir selbständig und ohne unerlaubte Hilfe angefertigt ist. München, den 31. 01. 2013 Bernadette Schreiner Dissertation eingereicht am: 11. 12. 2012 Tag der mündlichen Prüfung: 29. 01. 2013 Erstgutachter: Prof. Dr. Jürgen Soll Zweitgutachter: Prof. Dr. Ute Vothknecht Sondergutachter: Prof. Dr. Dr. Walter Neupert Für meine Familie INTRODUCTION TABLE OF CONTENTS 1. INTRODUCTION ................................................................................................7 1.1 Cellular protein quality control systems ...............................................................7 1.1.1 Proteins - the worker molecules of the cell ........................................................7 1.1.2 Protein quality control and homeostasis (proteostasis) ......................................8 1.1.3 Failure of protein quality control and homeostasis ............................................9 1.2 Molecular chaperones .............................................................................................9 1.2.1 The Hsp70 system ............................................................................................10 1.2.2 The chaperonins ...............................................................................................10 1.2.3 The Hsp90 system ............................................................................................11 1.2.4 The Hsp100 system ..........................................................................................13 1.3 Proteolytic systems ................................................................................................13 1.3.1 The AAA protein family ..................................................................................13 1.3.1 The AAA protease family ................................................................................14 1.3.2 LON proteases..................................................................................................15 1.3.3 ClpP proteases ..................................................................................................16 1.3.4 FtsH proteases ..................................................................................................17 1.4 Mitochondrial biogenesis ......................................................................................18 1.4.1 Mitochondrial subcompartmentalization..........................................................18 1.4.2 Mitochondrial protein import ...........................................................................18 1.5 Mitochondrial protein quality control.................................................................22 1.5.1 Protein quality control in the mitochondrial outer membrane .........................23 1.5.2 Protein quality control in the mitochondrial matrix .........................................23 1.5.3 Protein quality control in the mitochondrial inner membrane .........................25 1.5.4 Protein quality control in the mitochondrial intermembrane space .................25 1.6 Mitochondrial m-and i-AAA protease .................................................................26 1.7 Aim of the present study .......................................................................................30 2. MATERIALS AND METHODS.......................................................................31 2.1 Molecular biology methods...................................................................................31 2.1.1 Strategies for isolation of DNA........................................................................31 2.1.2 Enzymatic editing of DNA...............................................................................33 2.1.3 DNA purification and analysis .........................................................................33 2.1.4 E. coli strains ....................................................................................................34 2.1.5 Plasmids and cloning strategies........................................................................35 2.2 Yeast genetic methods ...........................................................................................38 2.3 Protein biochemistry methods..............................................................................44 2.3.1 Analytical methods...........................................................................................44 2.3.2 Preparation of proteins .....................................................................................46 2.4 Cell biology methods .............................................................................................49 2.4.1 NaOH cell disruption .......................................................................................49 2.4.2 “Rödel’s” cell disruption ..................................................................................49 2.4.3 “Fast Mitoprep”................................................................................................49 2.4.4 “Big Mitoprep”.................................................................................................50 2.4.5 Generation of mitoplasts ..................................................................................51 2.4.6 Digitonin fractionation of mitochondria...........................................................51 2.4.7 Protease treatment ............................................................................................52 2.4.8 Aggregation assay ............................................................................................52 2.4.9 Ni-NTA agarose pulldown ...............................................................................52 4 INTRODUCTION 2.5 Immunological methods........................................................................................53 2.5.1 Overview of antibodies prepared during this thesis .........................................53 2.5.2 Further antibodies used in this study................................................................53 2.5.3 Generation of specific antisera in rabbits .........................................................54 2.5.4 Detection of proteins on nitrocellulose membranes by immuno-staining........55 2.6 Special Methods .....................................................................................................55 2.6.1 Mass spectrometry of elution fractions of Ni-NTA agarose pulldown ............55 2.6.2 Identification of aggregating proteins by SILAC and mass spectrometry .......56 2.7 Chemicals, consumables and equipment.............................................................57 2.7.1 Chemicals .........................................................................................................57 2.7.2 Consumables ....................................................................................................60 2.7.3 Equipment ........................................................................................................60 3. RESULTS............................................................................................................62 3.1 Generation and characterization of model substrates for .................................62 investigating folding in the mitochondrial intermembrane space...........................62 3.1.1 Generation of an IMS-targeted Cytochrome b2-DHFR model substrate..........62 3.1.2 Optimization of induction of model substrate expression................................64 3.1.3 Expression of model substrate in S. cerevisiae ................................................65 3.1.4 Verification of the steady state levels of endogenous proteins in cells............66 expressing the model substrates ......................................................................66 3.1.5 Subcellular localization of model substrates expressed in vivo .......................67 3.1.6 Submitochondrial localization of the model substrates....................................68 3.2 Investigation of the folding behavior of the model substrates...........................70 3.2.1 In vivo protease resistance in the absence and presence of methotrexate ........70 3.2.2 Requirements for folding of DHFR in the IMS and matrix .............................71 3.3 Identification of potential folding helpers of DHFR in the IMS .......................73 3.3.1 Ni-NTA pulldown and label-free quantification by mass spectrometry ..........73 3.3.2 Confirmation of Ni-NTA pulldown by western blot and immuno-staining.....74 3.4 Generation and characterization of Yme1 deletion strain.................................75 3.4.1 Growth phenotype of Δyme1 strain ..................................................................75 3.4.2 Mitochondrial DNA in Δyme1 strain................................................................76 3.5 Behavior of the model substrate in the absence of Yme1 ..................................76 3.5.1 Expression of model substrates in Δyme1 strain ..............................................76 3.5.2 Effect of Yme1 on the folding of DHFR..........................................................77
Load more

Recommended publications
  • Recombinant E. Coli Lon Protease (C-6His)
    9853 Pacific Heights Blvd. Suite D. San Diego, CA 92121, USA Tel: 858-263-4982 Email: [email protected] 32-7101: Recombinant E. coli Lon Protease (C-6His) Gene : lon Gene ID : 945085 Uniprot ID : P0A9M0 Description Source: E.coli. MW :88.6kD. Recombinant E.coli Lon Protease is produced by our E.coli expression system and the target gene encoding Asn2-Lys784 is expressed with a 6His tag at the C-terminus. Lon Protease, is a member of the Lon protease family. They are found in archaea, bacteria and eukaryotes. Lon protease is ATP-dependent serine protease that mediates the selective degradation of mutant and abnormal proteins as well as certain short-lived regulatory proteins, including some antitoxins. It required for cellular homeostasis and for survival from DNA damage and developmental changes induced by stress. It degrades polypeptides processively to yield small peptide fragments that are 5 to 10 amino acids long and binds to DNA in a double-stranded, site- specific manner. Endogenous substrates include the regulatory proteins RcsA and SulA, the transcriptional activator SoxS, and UmuD. Its overproduction specifically inhibits translation through at least two different pathways, one of them being the YoeB- YefM toxin-antitoxin system. Product Info Amount : 10 µg / 50 µg Content : Supplied as a 0.2 µm filtered solution of 50mM TrisHCl, 100mM KCl, 10% Glycerol, pH 7.5 . Storage condition : Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. Amino Acid : MGNPERSERIEIPVLPLRDVVVYPHMVIPLFVGREKSIRCLEAAMDHDKKIMLVAQKEASTDEPGVN
    [Show full text]
  • M-AAA and I-AAA Complexes Coordinate to Regulate OMA1, The
    © 2018. Published by The Company of Biologists Ltd | Journal of Cell Science (2018) 131, jcs213546. doi:10.1242/jcs.213546 SHORT REPORT m-AAA and i-AAA complexes coordinate to regulate OMA1, the stress-activated supervisor of mitochondrial dynamics Francesco Consolato1,*, Francesca Maltecca1,*, Susanna Tulli1, Irene Sambri2 and Giorgio Casari1,2,‡ ABSTRACT and fission (L and S forms, respectively) (Anand et al., 2014). The The proteolytic processing of dynamin-like GTPase OPA1, mediated balance between long and short OPA1 forms is finely regulated by two by the activity of both YME1L1 [intermembrane (i)-AAA protease mitochondrial inner membrane proteases, OMA1 (Ehses et al., 2009) complex] and OMA1, is a crucial step in the regulation of mitochondrial and YME1L1, which cleave OPA1 at different sites (Song et al., 2007). dynamics. OMA1 is a zinc metallopeptidase of the inner mitochondrial The intermembrane (i)-AAA protease YME1L1 exposes its membrane that undergoes pre-activating proteolytic and auto- catalytic domain to the intermembrane space (Leonhard et al., 1996) proteolytic cleavage after mitochondrial import. Here, we identify and is responsible for generation of the S2-OPA1 form by proteolytic AFG3L2 [matrix (m)-AAA complex] as the major protease mediating cleavage, whereas OMA1 gives rise to the S1 and S3 forms (Anand this event, which acts by maturing the 60 kDa pre-pro-OMA1 to the et al., 2014; MacVicar and Langer, 2016; Quirós et al., 2012). 40 kDa pro-OMA1 form by severing the N-terminal portion without OMA1 harbours an M48 metallopeptidase domain and is the major recognizing a specific consensus sequence. Therefore, m-AAA and player in OPA1 processing under conditions of stress (Quirós et al., Δϕ i-AAA complexes coordinately regulate OMA1 processing and 2012).
    [Show full text]
  • Mitochondrial Protein Quality Control Mechanisms
    G C A T T A C G G C A T genes Review Mitochondrial Protein Quality Control Mechanisms Pooja Jadiya * and Dhanendra Tomar * Center for Translational Medicine, Lewis Katz School of Medicine, Temple University, Philadelphia, PA 19140, USA * Correspondence: [email protected] (P.J.); [email protected] (D.T.); Tel.: +1-215-707-9144 (D.T.) Received: 29 April 2020; Accepted: 15 May 2020; Published: 18 May 2020 Abstract: Mitochondria serve as a hub for many cellular processes, including bioenergetics, metabolism, cellular signaling, redox balance, calcium homeostasis, and cell death. The mitochondrial proteome includes over a thousand proteins, encoded by both the mitochondrial and nuclear genomes. The majority (~99%) of proteins are nuclear encoded that are synthesized in the cytosol and subsequently imported into the mitochondria. Within the mitochondria, polypeptides fold and assemble into their native functional form. Mitochondria health and integrity depend on correct protein import, folding, and regulated turnover termed as mitochondrial protein quality control (MPQC). Failure to maintain these processes can cause mitochondrial dysfunction that leads to various pathophysiological outcomes and the commencement of diseases. Here, we summarize the current knowledge about the role of different MPQC regulatory systems such as mitochondrial chaperones, proteases, the ubiquitin-proteasome system, mitochondrial unfolded protein response, mitophagy, and mitochondria-derived vesicles in the maintenance of mitochondrial proteome and health. The proper understanding of mitochondrial protein quality control mechanisms will provide relevant insights to treat multiple human diseases. Keywords: mitochondria; proteome; ubiquitin; proteasome; chaperones; protease; mitophagy; mitochondrial protein quality control; mitochondria-associated degradation; mitochondrial unfolded protein response 1. Introduction Mitochondria are double membrane, dynamic, and semiautonomous organelles which have several critical cellular functions.
    [Show full text]
  • Aneuploidy: Using Genetic Instability to Preserve a Haploid Genome?
    Health Science Campus FINAL APPROVAL OF DISSERTATION Doctor of Philosophy in Biomedical Science (Cancer Biology) Aneuploidy: Using genetic instability to preserve a haploid genome? Submitted by: Ramona Ramdath In partial fulfillment of the requirements for the degree of Doctor of Philosophy in Biomedical Science Examination Committee Signature/Date Major Advisor: David Allison, M.D., Ph.D. Academic James Trempe, Ph.D. Advisory Committee: David Giovanucci, Ph.D. Randall Ruch, Ph.D. Ronald Mellgren, Ph.D. Senior Associate Dean College of Graduate Studies Michael S. Bisesi, Ph.D. Date of Defense: April 10, 2009 Aneuploidy: Using genetic instability to preserve a haploid genome? Ramona Ramdath University of Toledo, Health Science Campus 2009 Dedication I dedicate this dissertation to my grandfather who died of lung cancer two years ago, but who always instilled in us the value and importance of education. And to my mom and sister, both of whom have been pillars of support and stimulating conversations. To my sister, Rehanna, especially- I hope this inspires you to achieve all that you want to in life, academically and otherwise. ii Acknowledgements As we go through these academic journeys, there are so many along the way that make an impact not only on our work, but on our lives as well, and I would like to say a heartfelt thank you to all of those people: My Committee members- Dr. James Trempe, Dr. David Giovanucchi, Dr. Ronald Mellgren and Dr. Randall Ruch for their guidance, suggestions, support and confidence in me. My major advisor- Dr. David Allison, for his constructive criticism and positive reinforcement.
    [Show full text]
  • (12) Patent Application Publication (10) Pub. No.: US 2006/0110747 A1 Ramseier Et Al
    US 200601 10747A1 (19) United States (12) Patent Application Publication (10) Pub. No.: US 2006/0110747 A1 Ramseier et al. (43) Pub. Date: May 25, 2006 (54) PROCESS FOR IMPROVED PROTEIN (60) Provisional application No. 60/591489, filed on Jul. EXPRESSION BY STRAIN ENGINEERING 26, 2004. (75) Inventors: Thomas M. Ramseier, Poway, CA Publication Classification (US); Hongfan Jin, San Diego, CA (51) Int. Cl. (US); Charles H. Squires, Poway, CA CI2O I/68 (2006.01) (US) GOIN 33/53 (2006.01) CI2N 15/74 (2006.01) Correspondence Address: (52) U.S. Cl. ................................ 435/6: 435/7.1; 435/471 KING & SPALDING LLP 118O PEACHTREE STREET (57) ABSTRACT ATLANTA, GA 30309 (US) This invention is a process for improving the production levels of recombinant proteins or peptides or improving the (73) Assignee: Dow Global Technologies Inc., Midland, level of active recombinant proteins or peptides expressed in MI (US) host cells. The invention is a process of comparing two genetic profiles of a cell that expresses a recombinant (21) Appl. No.: 11/189,375 protein and modifying the cell to change the expression of a gene product that is upregulated in response to the recom (22) Filed: Jul. 26, 2005 binant protein expression. The process can improve protein production or can improve protein quality, for example, by Related U.S. Application Data increasing solubility of a recombinant protein. Patent Application Publication May 25, 2006 Sheet 1 of 15 US 2006/0110747 A1 Figure 1 09 010909070£020\,0 10°0 Patent Application Publication May 25, 2006 Sheet 2 of 15 US 2006/0110747 A1 Figure 2 Ester sers Custer || || || || || HH-I-H 1 H4 s a cisiers TT closers | | | | | | Ya S T RXFO 1961.
    [Show full text]
  • Online Proofing
    elsevier_BBABIO_47641 Emerging role of Lon protease as a master regulator of mitochondrial functions Marcello Pintia, 1 Lara Gibellinib, 1 Milena Nasib Sara De Biasib Carlo Augusto Bortolottia Anna Iannonec Andrea Cossarizzab, ⁎ [email protected] aDepartment of Life Sciences, University of Modena and Reggio Emilia, Modena, Italy bDepartment of Surgery, Medicine, Dentistry and Morphological Sciences, University of Modena and Reggio Emilia, Modena, Italy cDepartment of Diagnostics, Clinical and Public Health Medicine, University of Modena and Reggio Emilia, Modena, Italy ⁎Corresponding author at: Department of Surgery, Medicine, Dentistry, and Morphological Sciences, University of Modena and Reggio Emilia, Via Campi, 287, 41125 Modena, Italy. 1Equally contributed to the paper. This article is part of a Special Issue entitled '‘EBEC 2016: 19th European Bioenergetics Conference, Riva del Garda, Italy, July 2‐–6, 2016'’, edited by Prof. Paolo Bernardi. Abstract Lon protease is a nuclear-encoded, mitochondrial ATP-dependent protease highly conserved throughout the evolution, crucial for the maintenance of mitochondrial homeostasis. Lon acts as a chaperone of misfolded proteins, and is necessary for maintaining mitochondrial DNA. The impairment of these functions has a deep impact on mitochondrial functionality and morphology. An altered expression of Lon leads to a profound reprogramming of cell metabolism, with a switch from respiration to glycolysis, which is often observed in cancer cells. Mutations of Lon, which likely impair its chaperone properties, are at the basis of a genetic inherited disease named of the cerebral, ocular, dental, auricular, skeletal (CODAS) syndrome. This article is part of a Special Issue entitled '‘EBEC 2016: 19th European Bioenergetics Conference, Riva del Garda, Italy, July 2‐–6, 2016'’, edited by Prof.
    [Show full text]
  • Thrombocytopenia-Associated Mutations in Ser/Thr Kinase MASTL Deregulate Actin Cytoskeletal Dynamics in Platelets
    Thrombocytopenia-associated mutations in Ser/Thr kinase MASTL deregulate actin cytoskeletal dynamics in platelets Begoña Hurtado, … , Pablo García de Frutos, Marcos Malumbres J Clin Invest. 2018;128(12):5351-5367. https://doi.org/10.1172/JCI121876. Research Article Cell biology Hematology Graphical abstract Find the latest version: https://jci.me/121876/pdf The Journal of Clinical Investigation RESEARCH ARTICLE Thrombocytopenia-associated mutations in Ser/Thr kinase MASTL deregulate actin cytoskeletal dynamics in platelets Begoña Hurtado,1,2 Marianna Trakala,1 Pilar Ximénez-Embún,3 Aicha El Bakkali,1 David Partida,1 Belén Sanz-Castillo,1 Mónica Álvarez-Fernández,1 María Maroto,1 Ruth Sánchez-Martínez,1 Lola Martínez4, Javier Muñoz,3 Pablo García de Frutos,2 and Marcos Malumbres1 1Cell Division and Cancer Group, Spanish National Cancer Research Centre (CNIO), Madrid, Spain. 2Department of Cell Death and Proliferation, Institut d’Investigacions Biomèdiques de Barcelona-Consejo Superior de Investigaciones Científicas- Institut d’Investigacions Biomèdiques August Pi i Sunyer- (IIBB-CSIC-IDIBAPS), Barcelona, Spain. 3ProteoRed – Instituto de Salud Carlos III (ISCIII) and Proteomics Unit, CNIO, Madrid, Spain. 4Cytometry Unit, CNIO, Madrid, Spain. MASTL, a Ser/Thr kinase that inhibits PP2A-B55 complexes during mitosis, is mutated in autosomal dominant thrombocytopenia. However, the connections between the cell-cycle machinery and this human disease remain unexplored. We report here that, whereas Mastl ablation in megakaryocytes prevented proper maturation of these cells, mice carrying the thrombocytopenia-associated mutation developed thrombocytopenia as a consequence of aberrant activation and survival of platelets. Activation of mutant platelets was characterized by hyperstabilized pseudopods mimicking the effect of PP2A inhibition and actin polymerization defects.
    [Show full text]
  • Oxygen Tension Modulates the Mitochondrial Genetic Bottleneck and Influences the Segregation of a Heteroplasmic Mtdna Variant in Vitro
    ARTICLE https://doi.org/10.1038/s42003-021-02069-2 OPEN Oxygen tension modulates the mitochondrial genetic bottleneck and influences the segregation of a heteroplasmic mtDNA variant in vitro Mikael G. Pezet1,2,6, Aurora Gomez-Duran1,2,7, Florian Klimm2,3,7, Juvid Aryaman1,2,3, Stephen Burr1,2, ✉ Wei Wei1,2, Mitinori Saitou4,5, Julien Prudent 2 & Patrick F. Chinnery 1,2 Most humans carry a mixed population of mitochondrial DNA (mtDNA heteroplasmy) affecting ~1–2% of molecules, but rapid percentage shifts occur over one generation leading to severe mitochondrial diseases. A decrease in the amount of mtDNA within the developing 1234567890():,; female germ line appears to play a role, but other sub-cellular mechanisms have been implicated. Establishing an in vitro model of early mammalian germ cell development from embryonic stem cells, here we show that the reduction of mtDNA content is modulated by oxygen and reaches a nadir immediately before germ cell specification. The observed genetic bottleneck was accompanied by a decrease in mtDNA replicating foci and the segregation of heteroplasmy, which were both abolished at higher oxygen levels. Thus, differences in oxygen tension occurring during early development likely modulate the amount of mtDNA, facil- itating mtDNA segregation and contributing to tissue-specific mutation loads. 1 Department of Clinical Neurosciences, School of Clinical Medicine, University of Cambridge, Cambridge Biomedical Campus, Cambridge CB2 0QQ, UK. 2 Medical Research Council Mitochondrial Biology Unit, University of Cambridge, Cambridge Biomedical Campus, Cambridge CB2 0XY, UK. 3 Department of Mathematics, Imperial College London, London SW7 2AZ, UK. 4 Department of Anatomy and Cell Biology, Graduate School of Medicine, Kyoto University, Kyoto 606-8501, Japan.
    [Show full text]
  • Duodenal Mucosal Mitochondrial Gene Expression Is Associated with Delayed Gastric Emptying in Diabetic Gastroenteropathy
    Duodenal mucosal mitochondrial gene expression is associated with delayed gastric emptying in diabetic gastroenteropathy Susrutha Puthanmadhom Narayanan, … , Tamas Ordog, Adil E. Bharucha JCI Insight. 2021;6(2):e143596. https://doi.org/10.1172/jci.insight.143596. Research Article Endocrinology Gastroenterology Graphical abstract Find the latest version: https://jci.me/143596/pdf RESEARCH ARTICLE Duodenal mucosal mitochondrial gene expression is associated with delayed gastric emptying in diabetic gastroenteropathy Susrutha Puthanmadhom Narayanan,1 Daniel O’Brien,2 Mayank Sharma,1 Karl Miller,3 Peter Adams,3 João F. Passos,4 Alfonso Eirin,5 Tamas Ordog,4 and Adil E. Bharucha1 1Division of Gastroenterology and Hepatology, Department of Medicine, Mayo Clinic, Rochester, Minnesota, USA. 2Department of Biomedical Statistics and Informatics, Mayo Clinic, Rochester, Minnesota, USA. 3Sanford Burnham Prebys Medical Discovery Institute, San Diego, California, USA. 4Department of Physiology and Biomedical Engineering and 5Division of Nephrology & Hypertension Research, Department of Medicine, Mayo Clinic, Rochester, Minnesota, USA. Hindered by a limited understanding of the mechanisms responsible for diabetic gastroenteropathy (DGE), management is symptomatic. We investigated the duodenal mucosal expression of protein- coding genes and microRNAs (miRNA) in DGE and related them to clinical features. The diabetic phenotype, gastric emptying, mRNA, and miRNA expression and ultrastructure of duodenal mucosal biopsies were compared in 39 DGE patients and 21 controls. Among 3175 differentially expressed genes (FDR < 0.05), several mitochondrial DNA–encoded (mtDNA-encoded) genes (12 of 13 protein coding genes involved in oxidative phosphorylation [OXPHOS], both rRNAs and 9 of 22 transfer RNAs) were downregulated; conversely, nuclear DNA–encoded (nDNA-encoded) mitochondrial genes (OXPHOS) were upregulated in DGE.
    [Show full text]
  • LONP1 Is Required for Maturation of a Subset of Mitochondrial Proteins and Its Loss Elicits
    bioRxiv preprint doi: https://doi.org/10.1101/306316; this version posted April 23, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. LONP1 is required for maturation of a subset of mitochondrial proteins and its loss elicits an integrated stress response Olga Zurita Rendón and Eric A. Shoubridge. Montreal Neurological Institute and Department of Human Genetics, McGill University, Montreal, QC, Canada. Eric A. Shoubridge, Montreal Neurological Institute, 3801 University Street, Montreal, Quebec, Canada H3A 2B4 Email: [email protected] Tel: 514-398-1997 FAX: 514-398-1509 bioRxiv preprint doi: https://doi.org/10.1101/306316; this version posted April 23, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Abstract LONP1, a AAA+ mitochondrial protease, is implicated in protein quality control, but its substrates and precise role in this process remain poorly understood. Here we have investigated the role of human LONP1 in mitochondrial gene expression and proteostasis. Depletion of LONP1 resulted in partial loss of mtDNA, complete suppression of mitochondrial translation, a marked increase in the levels of a distinct subset of mitochondrial matrix proteins (SSBP1, MTERFD3, FASTKD2 and CLPX), and the accumulation of their unprocessed forms, with intact mitochondrial targeting sequences, in an insoluble protein fraction.
    [Show full text]
  • Sarah Owdah Alomrani.Pdf
    Expression of the rice cystatin, Oryzacystatin-I (OC-I) influences the plant growth and development Sarah Owdah Alomrani Submitted in accordance with the requirements for the degree of Doctor of Philosophy The University of Leeds Faculty of Biological Sciences Centre for Plant Sciences September 2020 i The candidate confirms that the work submitted is his/her own and that appropriate credit has been given where reference has been made to the work of others. This copy has been supplied on the understanding that it is copyright material and that no quotation from the thesis may be published without proper acknowledgement. © 2020, The University of Leeds, Sarah Alomrani ii Acknowledgment Today, I have completed the writing of my thesis during the lockdown period which has been enforced due to the COVID-19 pandemic. Before I thank those who have support me through my journey, I would like to mention that, when I got divorced, around five years ago, I felt broken and I will always remember that my father told me: “You can start on your next chapter as an independent Saudi women”. I thought that the only thing that people will know about me was that I had been divorced, but now that is not the case. I have worked hard to obtain a scholarship to study in UK in my favourite subject, plant sciences, and the most important thing about me now is that I’m a strong women who no longer hopes for someone who would bring flowers for her, but I am able to plant my own flowers.
    [Show full text]
  • (12) United States Patent (10) Patent No.: US 9,353,359 B2 Sorek Et Al
    US009353359B2 (12) United States Patent (10) Patent No.: US 9,353,359 B2 Sorek et al. (45) Date of Patent: May 31, 2016 (54) BACTERIAL ANTI-PHAGE DEFENSE OTHER PUBLICATIONS SYSTEMS Copeland et al. 2007; Complete sequence of Pseudomonus (71) Applicant: Yeda Research and Development Co. mendocinaymp. EMBL: ABP83335.* Ltd., Rehovot (IL) Lucas et al. 2008; Complete sequence of Acidithiobacillus fer rooxidans ATCC 53993. EMBL: ACH83539.1. (72) Inventors: Rotem Sorek, Rehovot (IL); Hila Kerfeld et al. 2009; Complete sequence of plasmid of Amonifex Sberro, Rehovot (IL): Azita Leavitt, degensii KC4, EMBL: ACX53253.1.* Rehovot (IL) Lee et al. 2006; Sequence analysis of two cryptic plasmids from Bifidobacterium longump.O10A and construction of a shuttle clon (73) Assignee: Yeda Research and Development Co. ing vector. Applied Environmental Microbiology 72:527-535. Ltd., Rehovot (IL) EMBL: ACD97784.1. Alignment Only Being Sent.* Chenoll et al. 2012; Safety assessment of strain Bifidobacterium (*) Notice: Subject to any disclaimer, the term of this longum CECT 7347, a probiotic able to reduce the toxicity and patent is extended or adjusted under 35 inflammatory potential of gliadin-derived peptides, based on pheno U.S.C. 154(b) by 0 days. typic traits, whole genome sequencing, and murine trials. EMBL: CCK35109.18 (21) Appl. No.: 14/140,793 PajonEMBL et al. Clife2010; The genome sequenceC of Bifidobacterium longumgu Schell et al. 2002; The genome sequence of Bifidobacterium longum (22) Filed: Dec. 26, 2013 reflects its Apato the R gastrointestinal tract. SS (65) Prior Publication Data 12-1427 EMBL: AAN25255.1. Alignment Only Being US 2014/O178353 A1 Jun.
    [Show full text]