Anti-KCNF1 Monoclonal Antibody, Clone T3 (DCABH-12068) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Total Page：16

File Type：pdf, Size：1020Kb

Anti-KCNF1 monoclonal antibody, clone T3 (DCABH-12068) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily F. This gene is intronless and expressed in all tissues tested, including the heart, skeletal muscle, brain, kidney, and pancreas. Immunogen KCNF1 (AAH26110, 1 a.a. ~ 494 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype IgG2a Source/Host Mouse Species Reactivity Human Clone T3 Conjugate Unconjugated Applications Western Blot (Cell lysate); Western Blot (Recombinant protein); ELISA Sequence Similarities MDGSGERSLPEPGSQSSAASDDIEIVVNVGGVRQVLYGDLLSQYPETRLAELINCLAGGYDTIFS LCDDYDPGKREFYFDRDPDAFKCVIEVYYFGEVHMKKGICPICFKNEMDFWKVDLKFLDDCCKS HLSEKREELEEIARRVQLILDDLGVDAAEGRWRRCQKCVWKFLEKPESSCPARVVAVLSFLLILV SSVVMCMGTIPELQVLDAEGNRVEHPTLENVETACIGWFTLEYLLRLFSSPNKLHFALSFM Size 1 ea Buffer In ascites fluid Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved Gene Name KCNF1 potassium voltage-gated channel, subfamily F, member 1 [ Homo sapiens ] Official Symbol KCNF1 Synonyms KCNF1; potassium voltage-gated channel, subfamily F, member 1; KCNF; potassium voltage- gated channel subfamily F member 1; IK8; kH1; Kv5.1; potassium channel KH1; potassium channel Kv5.1; voltage-gated potassium channel subunit Kv5.1; KV5.1; MGC33316; Entrez Gene ID 3754 Protein Refseq NP_002227 UniProt ID Q9H3M0 Chromosome Location 2p25 Pathway Neuronal System, organism-specific biosystem; Potassium Channels, organism-specific biosystem; Voltage gated Potassium channels, organism-specific biosystem; Function potassium channel activity; voltage-gated ion channel activity; voltage-gated potassium channel activity; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.

Copy Link

Recommended publications

Table 2. Significant
Table 2. Significant (Q < 0.05 and |d | > 0.5) transcripts from the meta-analysis Gene Chr Mb Gene Name Affy ProbeSet cDNA_IDs d HAP/LAP d HAP/LAP d d IS Average d Ztest P values Q-value Symbol ID (study #5) 1 2 STS B2m 2 122 beta-2 microglobulin 1452428_a_at AI848245 1.75334941 4 3.2 4 3.2316485 1.07398E-09 5.69E-08 Man2b1 8 84.4 mannosidase 2, alpha B1 1416340_a_at H4049B01 3.75722111 3.87309653 2.1 1.6 2.84852656 5.32443E-07 1.58E-05 1110032A03Rik 9 50.9 RIKEN cDNA 1110032A03 gene 1417211_a_at H4035E05 4 1.66015788 4 1.7 2.82772795 2.94266E-05 0.000527 NA 9 48.5 --- 1456111_at 3.43701477 1.85785922 4 2 2.8237185 9.97969E-08 3.48E-06 Scn4b 9 45.3 Sodium channel, type IV, beta 1434008_at AI844796 3.79536664 1.63774235 3.3 2.3 2.75319499 1.48057E-08 6.21E-07 polypeptide Gadd45gip1 8 84.1 RIKEN cDNA 2310040G17 gene 1417619_at 4 3.38875643 1.4 2 2.69163229 8.84279E-06 0.0001904 BC056474 15 12.1 Mus musculus cDNA clone 1424117_at H3030A06 3.95752801 2.42838452 1.9 2.2 2.62132809 1.3344E-08 5.66E-07 MGC:67360 IMAGE:6823629, complete cds NA 4 153 guanine nucleotide binding protein, 1454696_at -3.46081884 -4 -1.3 -1.6 -2.6026947 8.58458E-05 0.0012617 beta 1 Gnb1 4 153 guanine nucleotide binding protein, 1417432_a_at H3094D02 -3.13334396 -4 -1.6 -1.7 -2.5946297 1.04542E-05 0.0002202 beta 1 Gadd45gip1 8 84.1 RAD23a homolog (S.
[Show full text]
Potassium Channels in Epilepsy
Downloaded from http://perspectivesinmedicine.cshlp.org/ on September 28, 2021 - Published by Cold Spring Harbor Laboratory Press Potassium Channels in Epilepsy Ru¨diger Ko¨hling and Jakob Wolfart Oscar Langendorff Institute of Physiology, University of Rostock, Rostock 18057, Germany Correspondence: [email protected] This review attempts to give a concise and up-to-date overview on the role of potassium channels in epilepsies. Their role can be defined from a genetic perspective, focusing on variants and de novo mutations identified in genetic studies or animal models with targeted, specific mutations in genes coding for a member of the large potassium channel family. In these genetic studies, a demonstrated functional link to hyperexcitability often remains elusive. However, their role can also be defined from a functional perspective, based on dy- namic, aggravating, or adaptive transcriptional and posttranslational alterations. In these cases, it often remains elusive whether the alteration is causal or merely incidental. With 80 potassium channel types, of which 10% are known to be associated with epilepsies (in humans) or a seizure phenotype (in animals), if genetically mutated, a comprehensive review is a challenging endeavor. This goal may seem all the more ambitious once the data on posttranslational alterations, found both in human tissue from epilepsy patients and in chronic or acute animal models, are included. We therefore summarize the literature, and expand only on key findings, particularly regarding functional alterations found in patient brain tissue and chronic animal models. INTRODUCTION TO POTASSIUM evolutionary appearance of voltage-gated so- CHANNELS dium (Nav)andcalcium (Cav)channels, Kchan- nels are further diversified in relation to their otassium (K) channels are related to epilepsy newer function, namely, keeping neuronal exci- Psyndromes on many different levels, ranging tation within limits (Anderson and Greenberg from direct control of neuronal excitability and 2001; Hille 2001).
[Show full text]
Supplementary Table S4. FGA Co-Expressed Gene List in LUAD
Supplementary Table S4. FGA co-expressed gene list in LUAD tumors Symbol R Locus Description FGG 0.919 4q28 fibrinogen gamma chain FGL1 0.635 8p22 fibrinogen-like 1 SLC7A2 0.536 8p22 solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 DUSP4 0.521 8p12-p11 dual specificity phosphatase 4 HAL 0.51 12q22-q24.1histidine ammonia-lyase PDE4D 0.499 5q12 phosphodiesterase 4D, cAMP-specific FURIN 0.497 15q26.1 furin (paired basic amino acid cleaving enzyme) CPS1 0.49 2q35 carbamoyl-phosphate synthase 1, mitochondrial TESC 0.478 12q24.22 tescalcin INHA 0.465 2q35 inhibin, alpha S100P 0.461 4p16 S100 calcium binding protein P VPS37A 0.447 8p22 vacuolar protein sorting 37 homolog A (S. cerevisiae) SLC16A14 0.447 2q36.3 solute carrier family 16, member 14 PPARGC1A 0.443 4p15.1 peroxisome proliferator-activated receptor gamma, coactivator 1 alpha SIK1 0.435 21q22.3 salt-inducible kinase 1 IRS2 0.434 13q34 insulin receptor substrate 2 RND1 0.433 12q12 Rho family GTPase 1 HGD 0.433 3q13.33 homogentisate 1,2-dioxygenase PTP4A1 0.432 6q12 protein tyrosine phosphatase type IVA, member 1 C8orf4 0.428 8p11.2 chromosome 8 open reading frame 4 DDC 0.427 7p12.2 dopa decarboxylase (aromatic L-amino acid decarboxylase) TACC2 0.427 10q26 transforming, acidic coiled-coil containing protein 2 MUC13 0.422 3q21.2 mucin 13, cell surface associated C5 0.412 9q33-q34 complement component 5 NR4A2 0.412 2q22-q23 nuclear receptor subfamily 4, group A, member 2 EYS 0.411 6q12 eyes shut homolog (Drosophila) GPX2 0.406 14q24.1 glutathione peroxidase
[Show full text]
An Advance About the Genetic Causes of Epilepsy
E3S Web of Conferences 271, 03068 (2021) https://doi.org/10.1051/e3sconf/202127103068 ICEPE 2021 An advance about the genetic causes of epilepsy Yu Sun1, a, *, †, Licheng Lu2, b, *, †, Lanxin Li3, c, *, †, Jingbo Wang4, d, *, † 1The School of Molecular and Cellular Biology, University of Illinois at Urbana-Champaign, Urbana, IL 61801-3633, US 2High School Affiliated to Shanghai Jiao Tong University, Shanghai, 200441, China 3Applied Biology program, University of British Columbia, Vancouver, V6r3b1, Canada 4School of Chemical Machinery and Safety, Dalian University of Technology, Dalian, 116023, China †These authors contributed equally. Abstract: Human hereditary epilepsy has been found related to ion channel mutations in voltage-gated channels (Na+, K+, Ca2+, Cl-), ligand gated channels (GABA receptors), and G-protein coupled receptors, such as Mass1. In addition, some transmembrane proteins or receptor genes, including PRRT2 and nAChR, and glucose transporter genes, such as GLUT1 and SLC2A1, are also about the onset of epilepsy. The discovery of these genetic defects has contributed greatly to our understanding of the pathology of epilepsy. This review focuses on introducing and summarizing epilepsy-associated genes and related findings in recent decades, pointing out related mutant genes that need to be further studied in the future. 1 Introduction Epilepsy is a neurological disorder characterized by 2 Malfunction of Ion channel epileptic seizures caused by abnormal brain activity. 1 in Functional variation in voltage or ligand-gated ion 100 (50 million people) people are affected by symptoms channel mutations is a major cause of idiopathic epilepsy, of this disorder worldwide, with men, young children, and especially in rare genetic forms.
[Show full text]
Ion Channels 3 1
r r r Cell Signalling Biology Michael J. Berridge Module 3 Ion Channels 3 1 Module 3 Ion Channels Synopsis Ion channels have two main signalling functions: either they can generate second messengers or they can function as effectors by responding to such messengers. Their role in signal generation is mainly centred on the Ca2 + signalling pathway, which has a large number of Ca2+ entry channels and internal Ca2+ release channels, both of which contribute to the generation of Ca2 + signals. Ion channels are also important effectors in that they mediate the action of different intracellular signalling pathways. There are a large number of K+ channels and many of these function in different + aspects of cell signalling. The voltage-dependent K (KV) channels regulate membrane potential and + excitability. The inward rectifier K (Kir) channel family has a number of important groups of channels + + such as the G protein-gated inward rectifier K (GIRK) channels and the ATP-sensitive K (KATP) + + channels. The two-pore domain K (K2P) channels are responsible for the large background K current. Some of the actions of Ca2 + are carried out by Ca2+-sensitive K+ channels and Ca2+-sensitive Cl − channels. The latter are members of a large group of chloride channels and transporters with multiple functions. There is a large family of ATP-binding cassette (ABC) transporters some of which have a signalling role in that they extrude signalling components from the cell. One of the ABC transporters is the cystic − − fibrosis transmembrane conductance regulator (CFTR) that conducts anions (Cl and HCO3 )and contributes to the osmotic gradient for the parallel flow of water in various transporting epithelia.
[Show full text]
Stem Cells and Ion Channels
Stem Cells International Stem Cells and Ion Channels Guest Editors: Stefan Liebau, Alexander Kleger, Michael Levin, and Shan Ping Yu Stem Cells and Ion Channels Stem Cells International Stem Cells and Ion Channels Guest Editors: Stefan Liebau, Alexander Kleger, Michael Levin, and Shan Ping Yu Copyright © 2013 Hindawi Publishing Corporation. All rights reserved. This is a special issue published in “Stem Cells International.” All articles are open access articles distributed under the Creative Com- mons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Editorial Board Nadire N. Ali, UK Joseph Itskovitz-Eldor, Israel Pranela Rameshwar, USA Anthony Atala, USA Pavla Jendelova, Czech Republic Hannele T. Ruohola-Baker, USA Nissim Benvenisty, Israel Arne Jensen, Germany D. S. Sakaguchi, USA Kenneth Boheler, USA Sue Kimber, UK Paul R. Sanberg, USA Dominique Bonnet, UK Mark D. Kirk, USA Paul T. Sharpe, UK B. Bunnell, USA Gary E. Lyons, USA Ashok Shetty, USA Kevin D. Bunting, USA Athanasios Mantalaris, UK Igor Slukvin, USA Richard K. Burt, USA Pilar Martin-Duque, Spain Ann Steele, USA Gerald A. Colvin, USA EvaMezey,USA Alexander Storch, Germany Stephen Dalton, USA Karim Nayernia, UK Marc Turner, UK Leonard M. Eisenberg, USA K. Sue O’Shea, USA Su-Chun Zhang, USA Marina Emborg, USA J. Parent, USA Weian Zhao, USA Josef Fulka, Czech Republic Bruno Peault, USA Joel C. Glover, Norway Stefan Przyborski, UK Contents Stem Cells and Ion Channels, Stefan Liebau,
[Show full text]
Ion Channels
UC Davis UC Davis Previously Published Works Title THE CONCISE GUIDE TO PHARMACOLOGY 2019/20: Ion channels. Permalink https://escholarship.org/uc/item/1442g5hg Journal British journal of pharmacology, 176 Suppl 1(S1) ISSN 0007-1188 Authors Alexander, Stephen PH Mathie, Alistair Peters, John A et al. Publication Date 2019-12-01 DOI 10.1111/bph.14749 License https://creativecommons.org/licenses/by/4.0/ 4.0 Peer reviewed eScholarship.org Powered by the California Digital Library University of California S.P.H. Alexander et al. The Concise Guide to PHARMACOLOGY 2019/20: Ion channels. British Journal of Pharmacology (2019) 176, S142–S228 THE CONCISE GUIDE TO PHARMACOLOGY 2019/20: Ion channels Stephen PH Alexander1 , Alistair Mathie2 ,JohnAPeters3 , Emma L Veale2 , Jörg Striessnig4 , Eamonn Kelly5, Jane F Armstrong6 , Elena Faccenda6 ,SimonDHarding6 ,AdamJPawson6 , Joanna L Sharman6 , Christopher Southan6 , Jamie A Davies6 and CGTP Collaborators 1School of Life Sciences, University of Nottingham Medical School, Nottingham, NG7 2UH, UK 2Medway School of Pharmacy, The Universities of Greenwich and Kent at Medway, Anson Building, Central Avenue, Chatham Maritime, Chatham, Kent, ME4 4TB, UK 3Neuroscience Division, Medical Education Institute, Ninewells Hospital and Medical School, University of Dundee, Dundee, DD1 9SY, UK 4Pharmacology and Toxicology, Institute of Pharmacy, University of Innsbruck, A-6020 Innsbruck, Austria 5School of Physiology, Pharmacology and Neuroscience, University of Bristol, Bristol, BS8 1TD, UK 6Centre for Discovery Brain Science, University of Edinburgh, Edinburgh, EH8 9XD, UK Abstract The Concise Guide to PHARMACOLOGY 2019/20 is the fourth in this series of biennial publications. The Concise Guide provides concise overviews of the key properties of nearly 1800 human drug targets with an emphasis on selective pharmacology (where available), plus links to the open access knowledgebase source of drug targets and their ligands (www.guidetopharmacology.org), which provides more detailed views of target and ligand properties.
[Show full text]
KCNF1 (NM 002236) Human Tagged ORF Clone – RC206124L1
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC206124L1 KCNF1 (NM_002236) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: KCNF1 (NM_002236) Human Tagged ORF Clone Tag: Myc-DDK Symbol: KCNF1 Synonyms: IK8; KCNF; kH1; KV5.1 Vector: pLenti-C-Myc-DDK (PS100064) E. coli Selection: Chloramphenicol (34 ug/mL) Cell Selection: None ORF Nucleotide The ORF insert of this clone is exactly the same as(RC206124). Sequence: Restriction Sites: SgfI-MluI Cloning Scheme: ACCN: NM_002236 ORF Size: 1482 bp This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 KCNF1 (NM_002236) Human Tagged ORF Clone – RC206124L1 OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at [email protected] or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g.
[Show full text]
Delta-9-Tetrahydrocannabinol Mediated Attenuation of Gastrointestinal Dysfunction in Chronic SIV-Infected Rhesus Macaques Involv
Delta-9-Tetrahydrocannabinol mediated attenuation of gastrointestinal dysfunction in chronic SIV-infected rhesus macaques involves differential modulation of epithelial DNA methylation and T cell activation 1 1 2 1 2 3 Vinay Kumar , Workineh Torben , Curtis Vande Stouwe , Bapi Pahar , Patricia E Molina · , Mahesh Mohan 1 1Division of Comparative Pathology, Tulane National Primate Research Center, Covington Louisiana- 70433, 2Department of Physiology, 3LSUHSC Alcohol and Drug Abuse Center, 1901 Perdido Street, Medical Education Building, New Orleans, Louisiana- 70112 Background. Medicinal and recreational cannabis use is widespread in HIV positive and inflammatory bowel disease patients. While we previously reported the ability of Delta-9- Tetrahydrocannabinol (L'.9-THC) to regulate gene/microRNA expression in the GI tract, it is unknown whether THC exerted these effects via epigenetic modulation of gene/microRNA expression. Methods. A modified reduced restricted bisulfite sequencing protocol was utilized to assess promoter DNA methylation in colonic epithelial cells (CE) of SIV-infected rhesus macaques (RMs) administered either vehicle (VEH/SIV; n=2) or L'.9-THC (THC/SIV; n=3). Results. At 6 months post SIV infection, relative to THC-SIV RMs, several CE genes in VEH-SIV RMs showed enhanced promoter hypermethylation. These included Wnt inhibitory factor-1, basic helix-loop-helix family, member a9, ADAM metallopeptidase with thrombospondin type 1 Motif, 20, Mesoderm specific transcript, TERT (Telomerase reverse transcriptase), POU class 3 homeobox 4, leucine zipper downregulated in cancer 1, potassium channels (KCNF1, KCNG3, KCNC1) and Death associated protein kinase 1. Further, immune response (MB21D1, MAMU-B18), apoptosis (phospholipid scramblase-3), epithelial growth (Stratifin, KLC2) and barrier function (CI GAL T1) genes and microRNAs (miR-130a/27b/24) showed hypomethylation in CE of VEH-SIV RMs.
[Show full text]
Molecular Specializations of Deep Cortical Layer Analogs in Songbirds Alexander A
www.nature.com/scientificreports OPEN Molecular specializations of deep cortical layer analogs in songbirds Alexander A. Nevue, Peter V. Lovell, Morgan Wirthlin & Claudio V. Mello* How the evolution of complex behavioral traits is associated with the emergence of novel brain pathways is largely unknown. Songbirds, like humans, learn vocalizations via tutor imitation and possess a specialized brain circuitry to support this behavior. In a comprehensive in situ hybridization efort, we show that the zebra fnch vocal robust nucleus of the arcopallium (RA) shares numerous markers (e.g. SNCA, PVALB) with the adjacent dorsal intermediate arcopallium (AId), an avian analog of mammalian deep cortical layers with involvement in motor function. We also identify markers truly unique to RA and thus likely linked to modulation of vocal motor function (e.g. KCNC1, GABRE), including a subset of the known shared markers between RA and human laryngeal motor cortex (e.g. SLIT1, RTN4R, LINGO1, PLXNC1). The data provide novel insights into molecular features unique to vocal learning circuits, and lend support for the motor theory for vocal learning origin. An in-depth understanding of how the brain controls learned behaviors and how these behaviors arise in specifc animal lineages requires detailed knowledge of the molecular organization of the underlying circuits. Songbirds ofer an excellent model for investigating these questions. Teir vocal circuitry has been extensively studied, and consists of interconnected pallial, basal ganglia, and thalamic components that control the production and acquisition of learned vocalizations1. As is typical of birds, the pallial (cortical-like) areas consist of discrete nuclei, in contrast to the layered cortex of mammals2–4.
[Show full text]
KCNF1 (NM 002236) Human Tagged ORF Clone – RC206124
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC206124 KCNF1 (NM_002236) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: KCNF1 (NM_002236) Human Tagged ORF Clone Tag: Myc-DDK Symbol: KCNF1 Synonyms: IK8; KCNF; kH1; KV5.1 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 5 KCNF1 (NM_002236) Human Tagged ORF Clone – RC206124 ORF Nucleotide >RC206124 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGACGGGTCCGGGGAGCGCAGCCTCCCGGAGCCGGGCAGCCAGAGCTCCGCTGCCAGCGACGACATAG AGATAGTCGTCAACGTGGGGGGCGTGCGGCAGGTGCTGTACGGGGACCTCCTCAGTCAGTACCCTGAGAC CCGGCTGGCGGAGCTCATCAACTGCTTGGCTGGGGGCTACGACACCATCTTCTCCCTGTGCGACGACTAC GACCCCGGCAAGCGCGAGTTCTACTTTGACAGGGACCCGGACGCCTTCAAGTGTGTCATCGAGGTGTACT ATTTCGGGGAGGTCCACATGAAGAAGGGCATCTGCCCCATCTGCTTCAAGAACGAGATGGACTTCTGGAA GGTGGACCTCAAGTTCCTGGACGACTGTTGCAAGAGCCACCTGAGCGAGAAGCGCGAGGAGCTGGAGGAG ATCGCGCGCCGCGTGCAGCTCATCCTGGACGACCTGGGCGTGGACGCGGCCGAGGGCCGCTGGCGCCGCT GCCAGAAGTGCGTCTGGAAGTTCCTGGAGAAGCCCGAGTCGTCGTGCCCGGCGCGGGTGGTGGCCGTGCT CTCCTTCCTGCTCATCCTCGTCTCGTCCGTGGTCATGTGCATGGGCACCATCCCCGAGCTGCAGGTGCTG
[Show full text]
KCNG3 (N-14): Sc-168241
SAN TA C RUZ BI OTEC HNOL OG Y, INC . KCNG3 (N-14): sc-168241 BACKGROUND SOURCE Neuronal and cardiac cells are excited by voltage-gated ion channels. Voltage- KCNG3 (N-14) is an affinity purified goat polyclonal antibody raised against gated K + channels in the plasma membrane control the repolarization and the a peptide mapping within an N-terminal cytoplasmic domain of KCNG3 of frequency of action potentials in neurons, muscles and other excitable cells. human origin. Mutations interfering with potassium ion channels are known to cause a vari - ety of disorders. A subunit of the potassium channel, KCNG3 (potassium volt - PRODUCT age-gated channel subfamily G member 3) is a 436 amino acid protein that Each vial contains 200 µg IgG in 1.0 ml of PBS with < 0.1% sodium azide modulates channel activity and forms a heteromultimer with KV2.1, KV3.1 and and 0.1% gelatin. KCNF1. KCNG3 contains an S4 domain that may serve as the voltage-sensor and is characterized by a series of positively charged amino acids at every Blocking peptide available for competition studies, sc-168241 P, (100 µg third position. KCNG3 localizes to the membrane, however it must be associ - pep tide in 0.5 ml PBS containing < 0.1% sodium azide and 0.2% BSA). ated with KV2.1 and possibly another partner to get inserted in the plasma membrane. KCNG3 is detected in testis, pancreas, lung, kidney, ovary, small APPLICATIONS intestine, colon, thymus, adrenal gland, spinal cord and in many parts of the KCNG3 (N-14) is recommended for detection of KCNG3 of mouse, rat and brain, with the exception of the cerebellum.
[Show full text]