
Anti-KCNF1 monoclonal antibody, clone T3 (DCABH-12068) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily F. This gene is intronless and expressed in all tissues tested, including the heart, skeletal muscle, brain, kidney, and pancreas. Immunogen KCNF1 (AAH26110, 1 a.a. ~ 494 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype IgG2a Source/Host Mouse Species Reactivity Human Clone T3 Conjugate Unconjugated Applications Western Blot (Cell lysate); Western Blot (Recombinant protein); ELISA Sequence Similarities MDGSGERSLPEPGSQSSAASDDIEIVVNVGGVRQVLYGDLLSQYPETRLAELINCLAGGYDTIFS LCDDYDPGKREFYFDRDPDAFKCVIEVYYFGEVHMKKGICPICFKNEMDFWKVDLKFLDDCCKS HLSEKREELEEIARRVQLILDDLGVDAAEGRWRRCQKCVWKFLEKPESSCPARVVAVLSFLLILV SSVVMCMGTIPELQVLDAEGNRVEHPTLENVETACIGWFTLEYLLRLFSSPNKLHFALSFM Size 1 ea Buffer In ascites fluid Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved Gene Name KCNF1 potassium voltage-gated channel, subfamily F, member 1 [ Homo sapiens ] Official Symbol KCNF1 Synonyms KCNF1; potassium voltage-gated channel, subfamily F, member 1; KCNF; potassium voltage- gated channel subfamily F member 1; IK8; kH1; Kv5.1; potassium channel KH1; potassium channel Kv5.1; voltage-gated potassium channel subunit Kv5.1; KV5.1; MGC33316; Entrez Gene ID 3754 Protein Refseq NP_002227 UniProt ID Q9H3M0 Chromosome Location 2p25 Pathway Neuronal System, organism-specific biosystem; Potassium Channels, organism-specific biosystem; Voltage gated Potassium channels, organism-specific biosystem; Function potassium channel activity; voltage-gated ion channel activity; voltage-gated potassium channel activity; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages2 Page
-
File Size-