Copyright by Jennifer Marie Powers 2009

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Copyright by Jennifer Marie Powers 2009 The Dissertation (or Treatise) Committee for Jennifer Marie Powers Certifies that this is the approved version of the following dissertation (or treatise): Re-Appropriating the Catholic Imaginary: Discourse Strategies and the Struggle for Modernization in Late Nineteenth-Century Religious Fiction Committee: Katherine M. Arens, Co-Supervisor James M. Boyden, Co-Supervisor Madeline C. Sutherland-Meier Judith G. Coffin Orlando R. Kelm Sandra B. Straubhaar Re-Appropriating the Catholic Imaginary: Discourse Strategies and the Struggle for Modernization in Late Nineteenth-Century Religious Fiction by Jennifer Marie Powers, B.A., M.A. Dissertation Presented to the Faculty of the Graduate School of The University of Texas at Austin in Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy The University of Texas at Austin August 2009 Dedication To my family Acknowledgements If every dissertation has a story, then mine has been one academically figured by my extraordinary professor and advisor Katherine Arens (University of Texas at Austin). She has guided this project from its inception through all its various phases. And she has lent it her time, her breadth of knowledge, and her drive. I owe her a great deal. To this gratitude, I know, she might say that she simply has the work ethic of a “post-war child.” But, I like to think of her in terms of the Catholic culture that interests us both: as Katherine of Alexandria, legendary patron saint of students and scholars. Apart from Professor Arens, I equally wish to acknowledge the contributions of and to express my sincerest gratitude to other members of my committee. Professor James Boyden (Tulane University) has been yet another source of inspiration for me: his classes and reading recommendations over the years have largely guided my study of Spanish history. His presence on the committee and in the Defense, particularly, made the process seem somehow less daunting, and even convivial. To (University of Texas) Professors Madeline Sutherland-Meier, Judith Coffin, Orlando Kelm, and Sandra Straubhaar I especially owe many thanks for extending themselves during the summer semester to offer good criticism and editorial comments in the Defense and on the dissertation draft. v Invaluable assistance with this project was also offered by associates, particularly during the time that I spent finishing it at a distance from my university (when aspects of university life, such as library access, became a coveted privilege). Professor Beatrice Pita (University of California, San Diego) made kind accommodations and provided me a source of continued scholarly connection. Wendy Nesmith, a supervisor of Inter Library Services at the University of Texas (and also an empathetic Ph. D.), served as a dependable contact for filling my often-obscure materials’ requests. Hugo Chapa- Guzmán, cataloguer for Ibero-American collections at the library, kindly assisted me in many instances to tap into special subject-area and more general library resources. I wish to acknowledge his comprehensive web-based guide to Iberian studies (<http://www.lib.utexas.edu/subject/iberian/>), to which I often referred. Special thanks goes to Professor Cameron Turner (Colorado School of Mines) who has been, at different times, a fellow dissertation writer, a creative / collaborative peer, a cyber co-worker, and an impromptu mentor on “all things dissertation.” I am grateful to my father for his strong belief in education, which has been influential, and for his particular understanding of finishing seemingly all-consuming projects and, also, to my mother for her ceaseless faithfulness and optimism and for her biased view that everything I write is worth saving. And I remain lovingly indebted to my husband, my steady ship, for his support in all manners throughout this endeavor, but above all for his patience in enduring the “lack of me” for so long. (Let’s go sailing!) vi Re-Appropriating the Catholic Imaginary: Discourse Strategies and the Struggle for Modernization in Late Nineteenth-Century Religious Fiction Publication No._____________ Jennifer Marie Powers, Ph.D. The University of Texas at Austin, 2009 Co-Supervisors: Katherine M. Arens and James M. Boyden This project explores how literary authors used religious discourses in the socio- intellectual climates of late nineteenth-century Catholic cultures. It takes its premise from a tacit paradox of Western European modernization: unlike other Western European nations, nations such as France and Spain modernized without adopting Protestantism or doctrines of anti-Catholicism or anticlericalism--and, thus, without a strict break into national secular discourses. Addressing how various religious discourses were used in modernizing France and Spain (respectively, from 1848 and from 1868 to the early twentieth century), I take a cultural-historical approach to representative religiously themed novels and short fiction of the periods. I contend that non-institutionalized traditional Catholic culture (a culture's “religious imaginary” or “Catholic imaginary”) offered authors a plural and, thus, strategic source for making cultural critiques. These critiques would have resonated widely with contemporaneous readerships, and often without overt confrontations (as vii anticlericalism has historically done). I point to the presence of such critiques specifically in canonical authors’ religious works--works often considered to be aberrational or “too Catholic” to be valued as modern vis-à-vis the landmarks of Western literature. Taking as my key example a novel by the “father of the modern Spanish novel,” Benito Pérez Galdós’s Misericordia or Compassion (1897), I unfold progressive readings of this text based on discourses borrowing historical, thematic, and stylistic elements from the archives of a Catholic imaginary. Thereafter, I broaden my argument by considering how comparable, but distinct, discourses inform social-critical readings of Victor Hugo’s Les Misérables or The Underclass (1862), Gustave Flaubert’s “Un Coeur simple” or “A Simple Heart” (1877), and Emilia Pardo Bazán’s “Un destripador de antaño” or “The Heart Lover” (1900). Overall, the project challenges a critical status quo that has chosen to identify canonical literature in reference to a secular aesthetic program, without allowing for the possibility that cultural-religious discourses might also carry weight for cultures that were modernizing. Additionally, it re-characterizes the modernizing intellectual, seen typically as spiritually cynical or atheist, as one acknowledging the populist force of the religious imaginary freed from church limits. viii Table of Contents Introduction: Re-Reading Nineteenth-Century “Religious Literature” ..................1 Project Structure and Chapter Sequence ......................................................7 A New Precedent for an Old Critical Trend ..............................................12 The “Catholic Imaginary” as Strategic Rhetorical Device .........................17 A Model: Benito Pérez Galdós’s Misericordia ..........................................27 Beginning the Task ...................................................................................35 Chapter One: The National Spaniard Behind New Criticism’s “Transcendent” Artist.........................................................................................................37 Misericordia’s Preface, or Galdós’s Word on Realism Suppressed.............39 The Bad Rap of “Galdós, el garbancero” ...................................................48 Rewriting Galdós as Christian ...................................................................54 The Advent of Misericordia as Galdós’s “Spiritual Good Child” ...............60 Towards Reclaiming the Realist and his Work...........................................69 Chapter Two: Almudena as Catholic Patron for a Syncretic Spain.....................71 The Critics’ Almudena, From Syncretic to Exclusionary ...........................72 Our Lady of the Almudena as the Myth of Catholic Spain .........................81 Galdós’s Almudena or a Counter-Narrative of Spanish Nationalism, Part I: Historical-Religious “Name Games” ......................................91 Galdós’s Almudena or a Counter-Narrative of Spanish Nationalism, Part II: “Ritualistic Play” ................................................................103 A Note on a Contemporaneous Institutional-Religious Shelter for “la morenita”........................................................................................113 Chapter Three: Benina’s Denial of the “Saint” in St. Rita.................................125 The Critical Persistence of Benina as Saintly...........................................126 A Problematic Signifier for a Catholic Signified......................................132 The Testimony of Three Non-Miracles....................................................141 “No soy santa” in Cultural-Historical Perspective....................................160 Social Saints, Social Critiques: Some Conclusions ..................................170 ix Chapter Four: St. Romuald, The Reformist Disguise of Benina and the “Good Child” ..........................................................................................174 The Critics’ Multiple Romualdos, or a Paucity of Vision on the Poorhouse Priest .............................................................................176 A Catholic Case of Mistaken Identity: Doña
Recommended publications
  • Qualitative Freedom

    Qualitative Freedom

    Claus Dierksmeier Qualitative Freedom - Autonomy in Cosmopolitan Responsibility Translated by Richard Fincham Qualitative Freedom - Autonomy in Cosmopolitan Responsibility Claus Dierksmeier Qualitative Freedom - Autonomy in Cosmopolitan Responsibility Claus Dierksmeier Institute of Political Science University of Tübingen Tübingen, Baden-Württemberg, Germany Translated by Richard Fincham American University in Cairo New Cairo, Egypt Published in German by Published by Transcript Qualitative Freiheit – Selbstbestimmung in weltbürgerlicher Verantwortung, 2016. ISBN 978-3-030-04722-1 ISBN 978-3-030-04723-8 (eBook) https://doi.org/10.1007/978-3-030-04723-8 Library of Congress Control Number: 2018964905 © The Editor(s) (if applicable) and The Author(s) 2019. This book is an open access publication. Open Access This book is licensed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence and indicate if changes were made. The images or other third party material in this book are included in the book’s Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the book’s Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. The use of general descriptive names, registered names, trademarks, service marks, etc. in this publication does not imply, even in the absence of a specific statement, that such names are exempt from the relevant protective laws and regulations and therefore free for general use.
  • B Philosophy (General) B

    B Philosophy (General) B

    B PHILOSOPHY (GENERAL) B Philosophy (General) For general philosophical treatises and introductions to philosophy see BD10+ Periodicals. Serials 1.A1-.A3 Polyglot 1.A4-Z English and American 2 French and Belgian 3 German 4 Italian 5 Spanish and Portuguese 6 Russian and other Slavic 8.A-Z Other. By language, A-Z Societies 11 English and American 12 French and Belgian 13 German 14 Italian 15 Spanish and Portuguese 18.A-Z Other. By language, A-Z 20 Congresses Collected works (nonserial) 20.6 Several languages 20.8 Latin 21 English and American 22 French and Belgian 23 German 24 Italian 25 Spanish and Portuguese 26 Russian and other Slavic 28.A-Z Other. By language, A-Z 29 Addresses, essays, lectures Class here works by several authors or individual authors (31) Yearbooks see B1+ 35 Directories Dictionaries 40 International (Polyglot) 41 English and American 42 French and Belgian 43 German 44 Italian 45 Spanish and Portuguese 48.A-Z Other. By language, A-Z Terminology. Nomenclature 49 General works 50 Special topics, A-Z 51 Encyclopedias 1 B PHILOSOPHY (GENERAL) B Historiography 51.4 General works Biography of historians 51.6.A2 Collective 51.6.A3-Z Individual, A-Z 51.8 Pictorial works Study and teaching. Research Cf. BF77+ Psychology Cf. BJ66+ Ethics Cf. BJ66 Ethics 52 General works 52.3.A-Z By region or country, A-Z 52.5 Problems, exercises, examinations 52.65.A-Z By school, A-Z Communication of information 52.66 General works 52.67 Information services 52.68 Computer network resources Including the Internet 52.7 Authorship Philosophy.
  • The Tragic Sense of Life by Miguel De Unamuno

    The Tragic Sense of Life by Miguel De Unamuno

    The Project Gutenberg EBook of Tragic Sense Of Life, by Miguel de Unamuno This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever. You may copy it, give it away or re-use it under the terms of the Project Gutenberg License included with this eBook or online at www.gutenberg.net Title: Tragic Sense Of Life Author: Miguel de Unamuno Release Date: January 8, 2005 [EBook #14636] Language: English Character set encoding: ISO-8859-1 *** START OF THIS PROJECT GUTENBERG EBOOK TRAGIC SENSE OF LIFE *** Produced by David Starner, Martin Pettit and the PG Online Distributed Proofreading Team TRAGIC SENSE OF LIFE MIGUEL DE UNAMUNO translator, J.E. CRAWFORD FLITCH DOVER PUBLICATIONS, INC New York This Dover edition, first published in 1954, is an unabridged and unaltered republication of the English translation originally published by Macmillan and Company, Ltd., in 1921. This edition is published by special arrangement with Macmillan and Company, Ltd. The publisher is grateful to the Library of the University of Pennsylvania for supplying a copy of this work for the purpose of reproduction. Standard Book Number: 486-20257-7 Library of Congress Catalog Card Number: 54-4730 Manufactured in the United States of America Dover Publications, Inc. 180 Varick Street New York, N.Y. 10014 CONTENTS INTRODUCTORY ESSAY AUTHOR'S PREFACE I THE MAN OF FLESH AND BONE Philosophy and the concrete man—The man Kant, the man Butler, and the man Spinoza—Unity and continuity of the person—Man an end not a means—Intellectual necessities
  • Education, Fascism, and the Catholic Church in Franco's Spain

    Education, Fascism, and the Catholic Church in Franco's Spain

    Loyola University Chicago Loyola eCommons Dissertations Theses and Dissertations 2011 Education, Fascism, and the Catholic Church in Franco's Spain Joan Domke Loyola University Chicago Follow this and additional works at: https://ecommons.luc.edu/luc_diss Part of the Educational Administration and Supervision Commons Recommended Citation Domke, Joan, "Education, Fascism, and the Catholic Church in Franco's Spain" (2011). Dissertations. 104. https://ecommons.luc.edu/luc_diss/104 This Dissertation is brought to you for free and open access by the Theses and Dissertations at Loyola eCommons. It has been accepted for inclusion in Dissertations by an authorized administrator of Loyola eCommons. For more information, please contact [email protected]. This work is licensed under a Creative Commons Attribution-Noncommercial-No Derivative Works 3.0 License. Copyright © 2011 Joan Domke LOYOLA UNIVERSITY CHICAGO EDUCATION, FASCISM, AND THE CATHOLIC CHURCH IN FRANCO‟S SPAIN A DISSERTATION SUBMITTED TO THE FACULTY OF THE GRADUATE SCHOOL IN CANDIDACY FOR THE DEGREE OF DOCTOR OF PHILOSOPHY PROGRAM IN CULTURAL AND EDUCATIONAL POLICY STUDIES BY JOAN CICERO DOMKE CHICAGO, IL MAY 2011 Copyright by Joan Domke, 2011 All rights reserved. ACKNOWLEDGMENTS I would like to thank Sr. Salvador Vergara, of the Instituto Cervantes in Chicago, for his untiring assistance in providing the most current and pertinent sources for this study. Also, Mrs. Nicia Irwin, of Team Expansion in Granada, Spain, made it possible, through her network of contacts, for present-day Spaniards to be an integral part in this research. Dr. Katherine Carroll gave me invaluable advice in the writing of the manuscript and Dr. John Cicero helped in the area of data analysis.
  • Intercultural Philosophy /Andean Philosophy Intercultural Theology, Andean Theology

    Intercultural Philosophy /Andean Philosophy Intercultural Theology, Andean Theology

    Josef Estermann Intercultural Philosophy /Andean Philosophy Intercultural Theology, Andean Theology An Anthology Digital Edition Barcelona 2021 Digital edition: © 2021 Josef Estermann / EIFI 2 Content Remark of the author ............................................................................................................. 4 1. «Anatopism» as cultural alienation: Dominant and dominated cultures in the Andean region of Latin America ................................................................................................. 5 2. Interfaith Dialogue and the Option for the Poor: Some methodological remarks ........ 25 3. Theology of Hope or Hope for Theology? ................................................................... 29 4. Apu Taytayku: Theological Implications of Andean Thought ...................................... 41 5. Like a Rainbow or a Bunch of Flowers: Contextual theologies in a globalized world 57 6. Jesus Christ as Chakana: Outline of an Andean Christology of Liberation ................ 77 7. Andean philosophy as a questioning alterity: An intercultural criticism of Western andro- and ethnocentrism ............................................................................................. 85 8. Religion does not redeem: Theological reflections about the role of «Religion» today .................................................................................................................................... 103 9. Proclaiming and struggling for life in plenitude: Buen Vivir (Good Living) as a new paradigm
  • Karl Krause and the Ideological Origins of the Cuban Revolution

    Karl Krause and the Ideological Origins of the Cuban Revolution

    Karl Krause and the Ideological Origins of the Cuban Revolution Richard Gott Institute of Latin American Studies 31 Tavistock Square London WC1H 9HA The Institute of Latin American Studies publishes as Occasional Papers selected seminar and conference papers and public lectures delivered at the Institute or by scholars associated with the work of the Institute. Richard Gott is a Visiting Research Fellow at the Institute of Latin American Studies, University of London. For many years he was a senior editor on the Guardian. Since the 1960s he has written extensively on Latin America, most recently In the Shadow of the Liberator: The Impact of Hugo Chávez on Venezuela and Latin America (2001). He is currently writing a history of Cuba. Occasional Papers, New Series 1992– ISSN 0953 6825 © Institute of Latin American Studies University of London, 2002 Karl Krause and the Ideological Origins of the Cuban Revolution Richard Gott The utopian German philosopher Karl Krause was defeated by Hegel in a competition for the philosophy professorship at Berlin University in 1813, and disappeared into obscurity as far as the Anglo-Saxon world was concerned. In the Hispanic sphere, however, his philosophy of harmonious rationalism fuelled the Spanish Revolution of 1868, and subsequently spread throughout Latin America, via José Martí and Hipólito Yrigoyen, to help create the intellectual climate in the early decades of the twentieth century in which Fidel Castro and Che Guevara were brought up. This paper suggests that the Cuban Revolution may owe as much to Karl Krause as it does to Karl Marx and to Hegel. The ‘special period’ in Cuba of the 1990s — as the memory of the Soviet Union slowly disappeared into history — saw the revival of official inter- est in two earlier heroes of the Revolution.
  • ABSTRACT the Existential Search for National, Individual and Spiritual

    ABSTRACT the Existential Search for National, Individual and Spiritual

    ABSTRACT The Existential Search for National, Individual and Spiritual Identity in Selected Works of Miguel de Unamuno Faith A. Rice-Mills, M.A. Committee Chairperson: Frieda H. Blackwell, Ph.D. Miguel de Unamuno, a well-known twentieth century Spanish writer and member of the Generation of ’98, exemplified the human struggle with collective and individual identity in many of his essays, dramas and novels. As a young writer, he and the other noventayochistas posed the question “who are we” to the Spanish people as they sought national identity and the true meaning of being Spanish. Later, Unamuno questioned individual purpose in life as well as the role of human life in relation to a divine Creator. One of Unamuno’s best known compilations of essays, En torno al casticismo (1912), addresses the question of “who are we” in reference to Spanish national identity, while two of his best known novels, Niebla (1914) and San Manuel Bueno, Mártir (1931), utilize the existential struggles of the protagonists to examine the questions and often tentative answers to the personal and spiritual existential quest for identity. The Existential Search for National, Individual and Spiritual Identity in Selected Works of Miguel de Unamuno by Faith A. Rice-Mills, B.A. A Thesis Approved by the Department of Modern Foreign Languages ___________________________________ Richard G. Durán, Ph.D., Interim Chairperson Submitted to the Graduate Faculty of Baylor University in Partial Fulfillment of the Requirements for the Degree of Master of Arts Approved by the Thesis Committee ___________________________________ Frieda H. Blackwell, Ph.D., Chairperson ___________________________________ Robert M. Baird, Ph.D.
  • The Panentheism of Karl Christian Friedrich Krause

    The Panentheism of Karl Christian Friedrich Krause

    5 BERLINER BIBLIOTHEK Religion – Kultur – Wissenschaft The book provides the first analysis of Karl Christian Friedrich Krause’s system of philosophy and his panentheism in English. Karl Christian Friedrich Krause has bequeathed to us a system of philosophy which is little recognised in contemporary philosophy. This is both surprising and Benedikt Paul Göcke unfortunate, because Krause’s philosophical system has much to offer: Through transcendental reflection on the nature of the human, Krause understands God as the one infinite and unconditioned reality, and the The Panentheism of ultimate necessary condition of knowledge. God makes humanity, nature, and reason ultimately comprehensible as the essential categories of the divine Essence. God is thus the single, primary, object of science that is Karl Christian Friedrich Krause already logically presupposed even before His discovery. Science presup- poses theology, and theology is best read as panentheism. (1781-1832) From Transcendental Philosophy to Metaphysics The Panentheism of Karl Krause Christian Friedrich Panentheism The Benedikt Paul Göcke is a Research Fellow at the Ian Ramsey Centre for Science and Religion and a Member of the Faculty of Theology at University of Oxford. He is also a Member of Blackfriars Hall, Oxford, and Professor of Philosophy of Science and Philosophy of Religion at Ruhr-Universität Bochum, Germany. Benedikt Paul Göcke · Benedikt Paul ISBN 978-3-631-74689-9 www.peterlang.com BEBI_005 274689_Goecke_JA_A5HC 151x214 globalL.indd 1 28.11.18 18:23 5 BERLINER BIBLIOTHEK Religion – Kultur – Wissenschaft The book provides the first analysis of Karl Christian Friedrich Krause’s system of philosophy and his panentheism in English.
  • Global Journal of Human Social Science

    Global Journal of Human Social Science

    Online ISSN : 2249-460X Print ISSN : 0975-587X The Origins of Feminism The Contribution of Islamic Study in Historical Origins Women Empowerment & Development VOLUME 14 ISSUE 5 VERSION 1.0 Global Journal of Human-Social Science: D History, Anthropology & Archaeology Global Journal of Human-Social Science: D History, Anthropology & Archaeology Volume 14 Issue 5 (Ver. 1.0) Open Association of Research Society Global Journals Inc. *OREDO-RXUQDORI+XPDQ (A Delaware USA Incorporation with “Good Standing”; Reg. Number: 0423089) Sponsors:Open Association of Research Society Social Sciences. 2014. Open Scientific Standards $OOULJKWVUHVHUYHG 7KLVLVDVSHFLDOLVVXHSXEOLVKHGLQYHUVLRQ Publisher’s Headquarters office RI³*OREDO-RXUQDORI+XPDQ6RFLDO 6FLHQFHV´%\*OREDO-RXUQDOV,QF Global Journals Headquarters $OODUWLFOHVDUHRSHQDFFHVVDUWLFOHVGLVWULEXWHG 301st Edgewater Place Suite, 100 Edgewater Dr.-Pl, XQGHU³*OREDO-RXUQDORI+XPDQ6RFLDO 6FLHQFHV´ Wakefield MASSACHUSETTS, Pin: 01880, 5HDGLQJ/LFHQVHZKLFKSHUPLWVUHVWULFWHGXVH United States of America (QWLUHFRQWHQWVDUHFRS\ULJKWE\RI³*OREDO USA Toll Free: +001-888-839-7392 -RXUQDORI+XPDQ6RFLDO6FLHQFHV´XQOHVV USA Toll Free Fax: +001-888-839-7392 RWKHUZLVHQRWHGRQVSHFLILFDUWLFOHV 1RSDUWRIWKLVSXEOLFDWLRQPD\EHUHSURGXFHG Offset Typesetting RUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQV HOHFWURQLFRUPHFKDQLFDOLQFOXGLQJ Global Journals Incorporated SKRWRFRS\UHFRUGLQJRUDQ\LQIRUPDWLRQ 2nd, Lansdowne, Lansdowne Rd., Croydon-Surrey, VWRUDJHDQGUHWULHYDOV\VWHPZLWKRXWZULWWHQ SHUPLVVLRQ Pin: CR9 2ER, United Kingdom 7KHRSLQLRQVDQGVWDWHPHQWVPDGHLQWKLV
  • The Transcendental Panentheism of Xavier Zubiri in Nature, History, God and Man and God

    The Transcendental Panentheism of Xavier Zubiri in Nature, History, God and Man and God

    The Xavier Zubiri Review, Vol. 13, 2013-2015, pp. 107-132 The Transcendental Panentheism Of Xavier Zubiri In Nature, History, God And Man And God C. Eduardo Sanchez Gauto, Th.M. Asunción, Paraguay Abstract Xavier Zubiri (1898-1983) was perhaps the most original and systematically rigorous think- er in contemporary Spanish philosophy; but he may also be the least known, due to cir- cumstances of his life that prevented him from occupying the center stage in Spain’s intel- lectual life. This paper intends to show that Xavier Zubiri’s theology is in fact a form of panentheism, a view of God where the world is in God via an ontological link, and yet God and the world are not identical. After a summary review of literature relevant for under- standing the question and some basic notions on panentheism, we analyze Zubirian theol- ogy as shown in two of Zubiri’s most important works: Nature, History, God and Man and God. The conclusion of this study is that Zubiri’s theology may be in fact a form of tran- scendental panentheism. Resumen Xavier Zubiri (1898–1983) fue quizás el pensador más original y más sistemáticamente ri- guroso de la filosofía española contemporánea; pero también es el menos conocido, debido a circunstancias de su vida que le impidieron ocupar un lugar central en la vida intelectual de España. Este trabajo busca mostrar que la teología de Xavier Zubiri es de hecho una forma de panenteísmo, una visión de Dios en donde el mundo está en Dios mediante un vínculo ontológico, y aun así Dios y el mundo no son idénticos.
  • CHAPTER I: a Pantheistic View of Reality

    CHAPTER I: a Pantheistic View of Reality

    CHAPTER I: A Pantheistic View of Reality The metaphysics of Antonio Machado is based on a pantheistic conception of reality. This pantheistic view not only appears in his prose writing, but also serves as the basis for many ideas expressed in his poetry. The lack of a comprehensive study of this aspect of his work has caused some confusion and misunderstanding in the interpretation of his religious and philosophical thought. Before I begin a study of his work, however, I will try to answer some fundamental questions. What is pantheism, and when has it appeared? What are the arguments that support a pantheistic view of reality, and what are those which oppose it? What is the relation of pantheism to traditional theism, and how is it viewed from the point of view of science and modern metaphysics. Giving an answer to these basic questions will permit us to have a clearer understanding of the metaphysical thought of the Spanish poet and philosopher. 1. A BRIEF HISTORY OF PANTHEISM THE PERENNIAL PHILOSOPHY Pantheism, one of the earliest and most permanent theological doctrines in the history of religious thought, affirms the unity of God and the universe. Aldous Huxley declares that this concept constitutes the essence of what has been called the Philosophia Perennis—an "immemorial and universal" part of all religions. As Huxley describes it pantheism—the "perennial philosophy"—is "the metaphysics that recognizes a divine Reality substantial to the world of things and lives and minds; the psychology that finds in the soul something similar to, or even identical with, the divine Reality; the ethic that places man's final end in the knowledge of the immanent and transcendent Ground of all being… Rudiments of the Perennial Philosophy may be found among the traditionary lore of primitive peoples in every region of the world, and in its fully developed forms it has a place in every one of the higher religions."1 In The History of Pantheism, C.
  • Philosophy and the Novel in Spain, 1900-1934

    Philosophy and the Novel in Spain, 1900-1934

    University of Kentucky UKnowledge Spanish Literature European Languages and Literatures 1993 Crossfire: Philosophy and the Novel in Spain, 1900-1934 Roberta Johnson University of Kansas Click here to let us know how access to this document benefits ou.y Thanks to the University of Kentucky Libraries and the University Press of Kentucky, this book is freely available to current faculty, students, and staff at the University of Kentucky. Find other University of Kentucky Books at uknowledge.uky.edu/upk. For more information, please contact UKnowledge at [email protected]. Recommended Citation Johnson, Roberta, "Crossfire: Philosophy and the Novel in Spain, 1900-1934" (1993). Spanish Literature. 4. https://uknowledge.uky.edu/upk_spanish_literature/4 STUDIES IN ROMANCE LANGUAGES: 3S John E. Keller, Editor This page intentionally left blank CROSSFKRE Philosophy and the Novel in Spain, 1900-1934 ROBERTA JOHNSON THE UNIVERSITY PRESS OF KENTUCKY Publication of this book was made possible by a grant from The Program for Cultural Cooperation between Spain’s Ministry of Culture and the United States Universities. Copyright © 1993 by The University Press of Kentucky Paperback edition 2009 The University Press of Kentucky Scholarly publisher for the Commonwealth, serving Bellarmine University, Berea College, Centre College of Kentucky, Eastern Kentucky University, The Filson Historical Society, Georgetown College, Kentucky Historical Society, Kentucky State University, Morehead State University, Murray State University, Northern Kentucky University, Transylvania University, University of Kentucky, University of Louisville, and Western Kentucky University. All rights reserved. Editorial and Sales Offices: The University Press of Kentucky 663 South Limestone Street, Lexington, Kentucky 40508-4008 www.kentuckypress.com Cataloging-in-Publication Data is available from the Library of Congress.