DOCSLIB.ORG

The Effect of Trans-Cinnamaldehyde on the Gene Expression Of

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
The Effect of Trans-Cinnamaldehyde on the Gene Expression Of 30 4 (2009 7 ) J Korean Oriental Med 2009;30(4):13-27 Original Article 선영재1, 최영곤1,2 , 정미영1,2 , 황세희1, 이제현4, 조정희5, 임사비나1,2,3 1경희대학교 대학원 한방응용의학과, 2경희대학교 동서의학연구소, 3경희대학교 대학원 기초한의과학과, 4동국대학교 한의과대학 본초학교실, 5전라남도한방산업진흥원 The Effect of Trans -cinnamaldehyde on the Gene Expression of Lipopolysaccharide-stimulated BV-2 Cells Using Microarray Analysis Young-Jae Sun 1, Yeong-Gon Choi 1,2 , Mi-Young Jeong 1,2 , Se-Hee Hwang 1, Je-Hyun Lee 4, Jung-Hee Cho 5, Sabina Lim 1,2,3 1Dept. of Applied Eastern Medicine, Grad. School, 2WHO Collaborating Ctr. for Traditional Medicine, East-West Med. Res. Institute, 3Dept. of Basic Eastern Medicinal Science, Grad. School, Kyung Hee University, 4Dept. of Herbology, Col. of Eastern Medicine, Dongguk University, Gyeongju, Republic of Korea, 5Jeollanamdo Development Institute for Traditional Korean Medicine Objectives: Trans -cinnamaldehyde (TCA) is the main component of Cinnamomi Ramulus and it has been reported that TCA inhibits inflammatory responses in various cell types. Inflammation-mediated neurological disorders induce the activation of macrophages such as microglia in brain, and these activated macrophages release various inflammation-related molecules, which can be neurotoxic if overproduced. In this study, we evaluated gene expression profiles using gene chip microarrays in lipopolysaccharide (LPS)-stimulated BV-2 cells to investigate the anti- inflammatory effect of TCA on inflammatory responses in brain microglia. Methods: A negative control group was cultured in normal medium and a positive control group was stimulated with 1 / LPS in the absence of TCA. TCA group was pretreated with 10 / TCA before 1 / LPS stimulation. The oligonucleotide microarray analysis was performed to obtain the expression profiles of 28,853 genes using gene chip mouse gene 1.0 ST array in this study. Results: In positive control group, 1522 probe sets were up-regulated in the condition of the cutoff value of 1.5-fold change and 341 genes with Unigene ID were retrieved. In TCA group, 590 probe sets were down-regulated from among 1522 probe sets and 33 genes with Unigene ID were retrieved, which included 6 inflammation-related genes. We found out that Id3 gene is associated with transforming growth factor- β (TGF- β) signaling pathway and Klra8 gene is related to natural killer cell-mediated cytotoxicity pathway. Conclusions: The results mean that TCA inhibits inflammatory responses through down-regulating the expressions of inflammation-related genes in LPS-stimulated BV-2 cells. Key Words : trans -cinnamaldehyde, lipopolysaccharide, microglia, BV-2, microarray Received ：15 January 2009 Revised ：14 May 2009 Accepted ：26 May 2009 Correspondence to ：임사비나(Sabina Lim) 서울시 동대문구 회기동 경희대학교 대학원 한방응용의학과 Tel ：+82-2-961-0324, Fax ：+82-2-961-7831, E-mail ：[email protected] 13 (470) 30 4 (2009 7 ) 서 론 9,10) . , microglia (Cinnamomi Ramulus) trans -cinnamaldehyde (TCA) 1) . 8) , 2) , TCA 3-5) . TCA RAW 264.7 cell Nitric oxide (NO) Inducible nitric oxide synthase (iNOS) TCA 3) . , TCA TCA endothelial cell cyclooxygenase-2 (COX-2) , Lipopolysaccharide (LPS) Prostaglandin E2 (PGE2) murine microglial cell line BV-2 4) , murine macrophage cell TCA human blood monocyte interleukin-1 (IL-1), tumor necrosis factor- α (TNF- α) microarray . 5) . mouse (macrophage) Oligonucleotide probe set microarray chip whole transcript sense target labeling assay 11) gene ontology (GO) TNF- . LPS α, IL-1 iNOS COX-2 eicosanoids, reactive oxygen , TCA LPS species (ROS), NO, superoxide (O 2) 6) , micr- clustering oglia pathway (microglial activation) TCA TNF- α, IL-1, IL-3, IL-5, IL-6, IL-8 . fibroblast growth factor- β (FGF- β), transforming growth factor- β1 (TGF- β1), nerve 재료 및 방법 growth factor (NGF) , brain-derived neurotrophic factor (BDNF), neurotrophin-3 (NT-3), 1. 시료의 제조 NT-4/5 NO TCA TCA 7,8) . HPLC (CNS) microglia . (Cinnamomi Ramulus) , microglia Cinnamomum cassia PRESL , , , , 14 6 : Trans-Cinnamaldehyde Lipopolysaccharide BV-2 cell : Microarray (471) . 200 g 80% 4. TCA 의 세포독성 실험 1500 3 . BV-2 cell 96well well 5000 1% 7 g FBS DMEM (low glucose) 24 ( 3.5%) . Dime- pre- incubation . TCA thylsulfoxide (DMSO) 20 / BV-2 cell TCA (1, 3, 10, 20, 30 . TCA Sigma / ) 48 MTS (3-(4,5-dimet- (MO, USA) . TCA hylthiazol-2-yl)- (3-carboxymethoxyphenyl)-2(4-sulf- Dulbecco’s modified Eagle’s medium (DMEM, Sigma ophenyl)-2H) assay . Cell Titer 96 chemical Co., MO, USA) Aqueous Cell Proliferation Assay kit (Promega, USA) BV-2 cell . MTS solution 20 4 . 2. 桂枝 추출물의 HPLC 분석 ELISA plate reader (Microplate manager, BioRad, Coumarin, TCA, USA) 490nm . cinnamic acid, glacial acetic acid Sigma-Aldrich Chemical Co. (MO, USA) . HPLC 5. 세포 배양과 실험군 분류 methanol (99.8%, Merck, Darmstadt, Germany) BV-2 cell 100 dish (Corning- Costar, USA) , (Mili-Q 10% FBS DMEM system, USA) . 3 HPLC (DIONEX SUMMIT HPLC System, Germany) . P680 HPLC pump, ASI-100 Automated Sample 10% FBS DMEM Injector, UVD 340U UV/VIS-detector, column (250 12-14 . BV-2 cell mm × 4.6 mm i.d.; particle size, 5μm; Phenomenex negative control , 1 Inc., CA, USA) , data CHRO- / LPS positive control , MELEON 6.70 Chromatography Management Software TCA LPS 1 (Dionex) . methanol TCA (10 / ) TCA - 0.01% acetic acid (50:50, v/v) . , 1.0 ml/min , UV 275nm 3 . TCA standard LPS 2 LPS curve HPLC 0.406, 0.081, 0.016 . , mg/mL . TCA 1 TCA 3. Cell culture . Mouse microglial cell line BV-2 cell 100 U/ 24 . penicillin, 100 / streptomycin (Gibco BRL, Grand Island, NY, USA) 10% fetal bovine serum 6. BV-2 cell 에서의 유전자 발현양 분석 (FBS; Gibco BRL, Grand Island, NY, USA) 1) Total RNA DMEM 37°C, 5% CO 2 incubator . BV-2 cell pellet phosphate buffer (PBS) 15 (472) 30 4 (2009 7 ) RNeasy Mini kit (QIAGEN, USA) (6) Second-Cycle, First-Strand cDNA synthesis protocol total RNA . Second-Cycle, First-Strand cDNA GeneChip total RNA spectrophotometer (Ultro- spec WT cDNA Synthesis Kit . 2000, Pharmacia Biotech Inc. USA) NaNoDrop (7) cRNA Single-Stranded DNA ND-1000 (NanoDrop Technologies, USA) Cleanup . cRNA Single-Stranded DNA Cleanup 2) Microarray Analysis GeneChip WT cDNA Amplification Kit Genechip Mouse Gene 1.0 ST array GeneChip Sample Cleanup Module . whole transcript sense targe labeling assay (Affymetrix, NanoDrop ND-1000 USA) manual Single-Stranded DNA 5.5 . (1) total RNA (8) Fragmentation of Single-Stranded DNA BV-2 cell total RNA 300 Single-Stranded DNA Fragmentation Gene- ng/3 . Chip WT Terminal Labeling Kit (Affymetrix Inc. USA) . 45 0.2 strip (2) total RNA T7-(N) 6 Primer, Poly-A RNA tube , 3 2% agarose control Mix gel ethidium- bromide total RNA 300 ng 3 T7-(N) 6 (ET- Br, Sigma-Aldrich, USA) fragme- Primer, Poly-A RNA control ntation . 2 5 70°C 5 4°C 2 . (9) Fragmented Single-Stranded DNA Labeling Fragmented Single-Stranded DNA Labeling (3) First-Cycle, First-strand cDNA GeneChip WT Terminal Labeling Kit First-Cycle, First-strand cDNA GeneChip . WT cDNA Synthesis Kit (Affymetrix Inc., USA) . (10) Hybridization Hybridization GeneChip Hybridization, Wash (4) First-Cycle, Second-Strand cDNA and Stain Kit (Affymetrix Inc., USA) . First-Cycle, Second-Strand cDNA GeneChip GeneChip ST Array septa hybridization WT cDNA Synthesis Kit . cocktail 80 septa 45°C, 60 rpm hybridization (5) First-Cycle, cRNA Synthesis and Cleanup oven 17±1 . First-Cycle, cRNA Synthesis and Cleanup GeneChip WT cDNA Amplification Kit Gene- (11) Fluidics Scanning Chip Sample Cleanup Module (Affymetrix Inc., USA) GeneChip ST Arrays Fluidics Protocols . NanoDrop ND-1000 (NanoDrop Fluidics Station 450 (Affymetrix Inc., USA) Technologies, USA) cRNA Fluidics Scripts FS450_0007 (Affymetrix Inc., USA) . 16 6 : Trans-Cinnamaldehyde Lipopolysaccharide BV-2 cell : Microarray (473) GeneChip Operating Software (GCOS, Affymetrix (Normalization) Quantile Normalization Inc., USA) GeneChip Scanner 3000 , log2 . 7G (Affymetrix Inc., USA) scan . Fold Change cutoff value 1.5 detection p-value 7. Data 분석 . (Clustering analysis) (Hierarchical clustering) Gene chip scan data GeneChip Operating . Pathway ( Software (Affymetrix Inc., USA), Expression Console ) Kyoto Encyclopedia Software (Affymetrix Inc., USA) GenPlex v3.0 of Genes and Genomes (KEGG) pathway (ISTECH Inc., Korea) 28,853 pathway P-value . Hybridization control oligonucleotide B2, bioB, bioC, bioDn, CreX, poly A controls, positive 결 과 vs negative area under the curve (pos_vs_neg_auc) . 1. 桂枝 추출물의 HPLC 분석 결과 signal intensity average Coumarin, TCA, cinnamic acid differential expression (AD) 277 nm, 290 nm, and 277 nm . UV 275 nm GenPlex v3.0 software (ISTECH Inc., Korea) , 0.01% acetic acid - BeadStudio Signal methanol (50:50, v/v) . (Preprocessing module normalization), HPLC coumarin, TCA, cinnamic (differentially expressed genes (DEG) finding acid retention time 7.2 , 12.3 , 16.0 module DEG ), (Clust- . chrom- ering module ) pathway atogram Fig. 1. (Pathway module chromatogram ) . AAA BBB Fig. 1. 17 (474) 30 4 (2009 7 ) (mean ± S.E.M.; n = 3), TCA 2) Chip internal controls 161.35 ± 1.55 mg/g . TCA control . control 2. TCA 의 세포독성 평가 hybridization Bio B, C, Dn, CreX 3` 5`, poly-A (lys, phe, BV-2 cell TCA thr, dap) , BV-2 cell TCA (Sigma-Aldrich, pos_vs_neg_auc . USA) 1, 3, 10, 20, 30 / Chip internal control MTS assay . (Fig. 2). TCA 10 / microarray 4. Microarray 실험 결과 . 1) Scan image 3. Gene chip 에 적용된 sample 의 상태 평가 (1) Hybridization gene chip biotin-labeled cDNA gene chip hybri- 1) cDNA Fragmentation dization scan pseudocolor Gene chip target cDNA . 2% agarose gel chip ET-Br cDNA (GeneChip Mouse Gene 1.0 ST array) fragmentation . , negative control cDNA size 4,000 bp . , fragmented cDNA 200 bp fragme- (2) Negative control positive control , TCA ntation . gene chip scan image 120 100 Cell viability (%) Cell viability 80 60 40 20 0 0 10 20 30 40 50 TCA(㎍/ml) Fig. 2. 18 6 : Trans-Cinnamaldehyde Lipopolysaccharide BV-2 cell : Microarray (475) AAABA BBBCCCC Fig.
Load more

Recommended publications
  • Human Placenta Exosomes: Biogenesis, Isolation, Composition, and Prospects for Use in Diagnostics
    International Journal of Molecular Sciences Review Human Placenta Exosomes: Biogenesis, Isolation, Composition, and Prospects for Use in Diagnostics Evgeniya E. Burkova 1,* , Sergey E. Sedykh 1,2 and Georgy A. Nevinsky 1,2 1 SB RAS Institute of Chemical Biology and Fundamental Medicine, 630090 Novosibirsk, Russia; [email protected] (S.E.S.); [email protected] (G.A.N.) 2 Department of Natural Sciences, Novosibirsk State University, 630090 Novosibirsk, Russia * Correspondence: [email protected]; Tel.: +7-(383)-363-51-27 Abstract: Exosomes are 40–100 nm nanovesicles participating in intercellular communication and transferring various bioactive proteins, mRNAs, miRNAs, and lipids. During pregnancy, the placenta releases exosomes into the maternal circulation. Placental exosomes are detected in the maternal blood even in the first trimester of pregnancy and their numbers increase significantly by the end of pregnancy. Exosomes are necessary for the normal functioning of the placenta and fetal development. Effects of exosomes on target cells depend not only on their concentration but also on their intrinsic components. The biochemical composition of the placental exosomes may cause various complications of pregnancy. Some studies relate the changes in the composition of nanovesicles to placental dysfunction. Isolation of placental exosomes from the blood of pregnant women and the study of protein, lipid, and nucleic composition can lead to the development of methods for early diagnosis of pregnancy pathologies. This review describes the biogenesis of exosomes, methods Citation: Burkova, E.E.; Sedykh, S.E.; of their isolation, analyzes their biochemical composition, and considers the prospects for using Nevinsky, G.A. Human Placenta exosomes to diagnose pregnancy pathologies.
    [Show full text]
  • Supporting Information
    Supporting Information Edgar et al. 10.1073/pnas.1601895113 SI Methods (Actimetrics), and recordings were analyzed using LumiCycle Mice. Sample size was determined using the resource equation: Data Analysis software (Actimetrics). E (degrees of freedom in ANOVA) = (total number of exper- – Cell Cycle Analysis of Confluent Cell Monolayers. NIH 3T3, primary imental animals) (number of experimental groups), with −/− sample size adhering to the condition 10 < E < 20. For com- WT, and Bmal1 fibroblasts were sequentially transduced − − parison of MuHV-4 and HSV-1 infection in WT vs. Bmal1 / with lentiviral fluorescent ubiquitin-based cell cycle indicators mice at ZT7 (Fig. 2), the investigator did not know the genotype (FUCCI) mCherry::Cdt1 and amCyan::Geminin reporters (32). of the animals when conducting infections, bioluminescence Dual reporter-positive cells were selected by FACS (Influx Cell imaging, and quantification. For bioluminescence imaging, Sorter; BD Biosciences) and seeded onto 35-mm dishes for mice were injected intraperitoneally with endotoxin-free lucif- subsequent analysis. To confirm that expression of mCherry:: Cdt1 and amCyan::Geminin correspond to G1 (2n DNA con- erin (Promega E6552) using 2 mg total per mouse. Following < ≤ anesthesia with isofluorane, they were scanned with an IVIS tent) and S/G2 (2 n 4 DNA content) cell cycle phases, Lumina (Caliper Life Sciences), 15 min after luciferin admin- respectively, cells were stained with DNA dye DRAQ5 (abcam) and analyzed by flow cytometry (LSR-Fortessa; BD Biosci- istration. Signal intensity was quantified using Living Image ences). To examine dynamics of replicative activity under ex- software (Caliper Life Sciences), obtaining maximum radiance perimental confluent conditions, synchronized FUCCI reporter for designated regions of interest (photons per second per − − − monolayers were observed by time-lapse live cell imaging over square centimeter per Steradian: photons·s 1·cm 2·sr 1), relative 3 d (Nikon Eclipse Ti-E inverted epifluorescent microscope).
    [Show full text]
  • A Chemical Proteomic Approach to Investigate Rab Prenylation in Living Systems
    A chemical proteomic approach to investigate Rab prenylation in living systems By Alexandra Fay Helen Berry A thesis submitted to Imperial College London in candidature for the degree of Doctor of Philosophy of Imperial College. Department of Chemistry Imperial College London Exhibition Road London SW7 2AZ August 2012 Declaration of Originality I, Alexandra Fay Helen Berry, hereby declare that this thesis, and all the work presented in it, is my own and that it has been generated by me as the result of my own original research, unless otherwise stated. 2 Abstract Protein prenylation is an important post-translational modification that occurs in all eukaryotes; defects in the prenylation machinery can lead to toxicity or pathogenesis. Prenylation is the modification of a protein with a farnesyl or geranylgeranyl isoprenoid, and it facilitates protein- membrane and protein-protein interactions. Proteins of the Ras superfamily of small GTPases are almost all prenylated and of these the Rab family of proteins forms the largest group. Rab proteins are geranylgeranylated with up to two geranylgeranyl groups by the enzyme Rab geranylgeranyltransferase (RGGT). Prenylation of Rabs allows them to locate to the correct intracellular membranes and carry out their roles in vesicle trafficking. Traditional methods for probing prenylation involve the use of tritiated geranylgeranyl pyrophosphate which is hazardous, has lengthy detection times, and is insufficiently sensitive. The work described in this thesis developed systems for labelling Rabs and other geranylgeranylated proteins using a technique known as tagging-by-substrate, enabling rapid analysis of defective Rab prenylation in cells and tissues. An azide analogue of the geranylgeranyl pyrophosphate substrate of RGGT (AzGGpp) was applied for in vitro prenylation of Rabs by recombinant enzyme.
    [Show full text]
  • Literature Mining Sustains and Enhances Knowledge Discovery from Omic Studies
    LITERATURE MINING SUSTAINS AND ENHANCES KNOWLEDGE DISCOVERY FROM OMIC STUDIES by Rick Matthew Jordan B.S. Biology, University of Pittsburgh, 1996 M.S. Molecular Biology/Biotechnology, East Carolina University, 2001 M.S. Biomedical Informatics, University of Pittsburgh, 2005 Submitted to the Graduate Faculty of School of Medicine in partial fulfillment of the requirements for the degree of Doctor of Philosophy University of Pittsburgh 2016 UNIVERSITY OF PITTSBURGH SCHOOL OF MEDICINE This dissertation was presented by Rick Matthew Jordan It was defended on December 2, 2015 and approved by Shyam Visweswaran, M.D., Ph.D., Associate Professor Rebecca Jacobson, M.D., M.S., Professor Songjian Lu, Ph.D., Assistant Professor Dissertation Advisor: Vanathi Gopalakrishnan, Ph.D., Associate Professor ii Copyright © by Rick Matthew Jordan 2016 iii LITERATURE MINING SUSTAINS AND ENHANCES KNOWLEDGE DISCOVERY FROM OMIC STUDIES Rick Matthew Jordan, M.S. University of Pittsburgh, 2016 Genomic, proteomic and other experimentally generated data from studies of biological systems aiming to discover disease biomarkers are currently analyzed without sufficient supporting evidence from the literature due to complexities associated with automated processing. Extracting prior knowledge about markers associated with biological sample types and disease states from the literature is tedious, and little research has been performed to understand how to use this knowledge to inform the generation of classification models from ‘omic’ data. Using pathway analysis methods to better understand the underlying biology of complex diseases such as breast and lung cancers is state-of-the-art. However, the problem of how to combine literature- mining evidence with pathway analysis evidence is an open problem in biomedical informatics research.
    [Show full text]
  • RAB2B (Human) Recombinant Protein (P01)
    Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic RAB2B (Human) Recombinant Ras superfamily that contain 4 highly conserved regions Protein (P01) involved in GTP binding and hydrolysis. Rab proteins are prenylated, membrane-bound proteins involved in Catalog Number: H00084932-P01 vesicular fusion and trafficking; see MIM 179508.[supplied by OMIM] Regulation Status: For research use only (RUO) Product Description: Human RAB2B full-length ORF ( NP_116235.2, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal. Sequence: MTYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTI GVEFGARMVNIDGKQIKLQIWDTAGQESFRSITRSYYR GAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVI MLIGNKSDLESRRDVKREEGEAFAREHGLIFMETSAKT ACNVEEAFINTAKEIYRKIQQGLFDVHNEANGIKIGPQQ SISTSVGPSASQRNSRDIGSNSGCC Host: Wheat Germ (in vitro) Theoretical MW (kDa): 50.6 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp
    [Show full text]
  • Isolation and Identification of Proteins from Swine Sperm Chromatin and Nuclear Matrix
    DOI: 10.21451/1984-3143-AR816 Anim. Reprod., v.14, n.2, p.418-428, Apr./Jun. 2017 Isolation and identification of proteins from swine sperm chromatin and nuclear matrix Guilherme Arantes Mendonça1,3, Romualdo Morandi Filho2, Elisson Terêncio Souza2, Thais Schwarz Gaggini1, Marina Cruvinel Assunção Silva-Mendonça1, Robson Carlos Antunes1, Marcelo Emílio Beletti1,2 1Post-graduation Program in Veterinary Science, Federal University of Uberlandia, Uberlandia, MG, Brazil. 2Post-graduation Program in Cellular and Molecular Biology, Federal University of Uberlandia, Uberlandia, MG, Brazil. Abstract (Yamauchi et al., 2011). According to the same authors, these active sperm chromatin sites in protamine toroids The aim of this study was to perform a may contain important epigenetic information for the proteomic analysis to isolate and identify proteins from developing embryo. the swine sperm nuclear matrix to contribute to a The isolated use of genomic and transcriptomic database of swine sperm nuclear proteins. We used pre- information may be insufficient to fully understand a chilled diluted semen from seven boars (19 to 24 week- complex organism because proteomics and old) from the commercial line Landrace x Large White transcriptomics can be discordant and DNA-RNA x Pietran. The semen was processed to separate the relationships cannot be fully correlated. Thus, sperm heads and extract the chromatin and nuclear measurements of other metabolic levels should also be matrix for protein quantification and analysis by mass obtained, such as the study of proteins (Wright et al., spectrometry, by LTQ Orbitrap ELITE mass 2012). According to these same authors, large-scale spectrometer (Thermo-Finnigan) coupled to a nanoflow protein research in organisms (i.e., the proteome-protein chromatography system (LC-MS/MS).
    [Show full text]
  • Agricultural University of Athens
    ΓΕΩΠΟΝΙΚΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΑΘΗΝΩΝ ΣΧΟΛΗ ΕΠΙΣΤΗΜΩΝ ΤΩΝ ΖΩΩΝ ΤΜΗΜΑ ΕΠΙΣΤΗΜΗΣ ΖΩΙΚΗΣ ΠΑΡΑΓΩΓΗΣ ΕΡΓΑΣΤΗΡΙΟ ΓΕΝΙΚΗΣ ΚΑΙ ΕΙΔΙΚΗΣ ΖΩΟΤΕΧΝΙΑΣ ΔΙΔΑΚΤΟΡΙΚΗ ΔΙΑΤΡΙΒΗ Εντοπισμός γονιδιωματικών περιοχών και δικτύων γονιδίων που επηρεάζουν παραγωγικές και αναπαραγωγικές ιδιότητες σε πληθυσμούς κρεοπαραγωγικών ορνιθίων ΕΙΡΗΝΗ Κ. ΤΑΡΣΑΝΗ ΕΠΙΒΛΕΠΩΝ ΚΑΘΗΓΗΤΗΣ: ΑΝΤΩΝΙΟΣ ΚΟΜΙΝΑΚΗΣ ΑΘΗΝΑ 2020 ΔΙΔΑΚΤΟΡΙΚΗ ΔΙΑΤΡΙΒΗ Εντοπισμός γονιδιωματικών περιοχών και δικτύων γονιδίων που επηρεάζουν παραγωγικές και αναπαραγωγικές ιδιότητες σε πληθυσμούς κρεοπαραγωγικών ορνιθίων Genome-wide association analysis and gene network analysis for (re)production traits in commercial broilers ΕΙΡΗΝΗ Κ. ΤΑΡΣΑΝΗ ΕΠΙΒΛΕΠΩΝ ΚΑΘΗΓΗΤΗΣ: ΑΝΤΩΝΙΟΣ ΚΟΜΙΝΑΚΗΣ Τριμελής Επιτροπή: Aντώνιος Κομινάκης (Αν. Καθ. ΓΠΑ) Ανδρέας Κράνης (Eρευν. B, Παν. Εδιμβούργου) Αριάδνη Χάγερ (Επ. Καθ. ΓΠΑ) Επταμελής εξεταστική επιτροπή: Aντώνιος Κομινάκης (Αν. Καθ. ΓΠΑ) Ανδρέας Κράνης (Eρευν. B, Παν. Εδιμβούργου) Αριάδνη Χάγερ (Επ. Καθ. ΓΠΑ) Πηνελόπη Μπεμπέλη (Καθ. ΓΠΑ) Δημήτριος Βλαχάκης (Επ. Καθ. ΓΠΑ) Ευάγγελος Ζωίδης (Επ.Καθ. ΓΠΑ) Γεώργιος Θεοδώρου (Επ.Καθ. ΓΠΑ) 2 Εντοπισμός γονιδιωματικών περιοχών και δικτύων γονιδίων που επηρεάζουν παραγωγικές και αναπαραγωγικές ιδιότητες σε πληθυσμούς κρεοπαραγωγικών ορνιθίων Περίληψη Σκοπός της παρούσας διδακτορικής διατριβής ήταν ο εντοπισμός γενετικών δεικτών και υποψηφίων γονιδίων που εμπλέκονται στο γενετικό έλεγχο δύο τυπικών πολυγονιδιακών ιδιοτήτων σε κρεοπαραγωγικά ορνίθια. Μία ιδιότητα σχετίζεται με την ανάπτυξη (σωματικό βάρος στις 35 ημέρες, ΣΒ) και η άλλη με την αναπαραγωγική
    [Show full text]
  • Comprehensive Knockout Analysis of the Rab Family Gtpases in Epithelial Cells
    Comprehensive knockout analysis of the Rab family GTPases in epithelial cells 著者 Yuta Homma, Riko Kinoshita, Yoshihiko Kuchitsu, Paulina S Wawro, Soujiro Marubashi, Mai E Oguchi, Mori´e Ishida, Naonobu Fujita, Mitsunori Fukuda journal or The journal of cell biology publication title volume 218 number 6 page range 2035-2050 year 2019-05-09 URL http://hdl.handle.net/10097/00127022 doi: 10.1083/jcb.201810134 Creative Commons : 表示 - 非営利 http://creativecommons.org/licenses/by-nc/3.0/deed.ja Published Online: 9 May, 2019 | Supp Info: http://doi.org/10.1083/jcb.201810134 Downloaded from jcb.rupress.org on November 6, 2019 TOOLS Comprehensive knockout analysis of the Rab family GTPases in epithelial cells Yuta Homma, Riko Kinoshita, Yoshihiko Kuchitsu, Paulina S. Wawro, Soujiro Marubashi, Mai E. Oguchi, Morie´ Ishida, Naonobu Fujita, and Mitsunori Fukuda The Rab family of small GTPases comprises the largest number of proteins (∼60 in mammals) among the regulators of intracellular membrane trafficking, but the precise function of many Rabs and the functional redundancy and diversity of Rabs remain largely unknown. Here, we generated a comprehensive collection of knockout (KO) MDCK cells for the entire Rab family. We knocked out closely related paralogs simultaneously (Rab subfamily knockout) to circumvent functional compensation and found that Rab1A/B and Rab5A/B/C are critical for cell survival and/or growth. In addition, we demonstrated that Rab6-KO cells lack the basement membrane, likely because of the inability to secrete extracellular matrix components. Further analysis revealed the general requirement of Rab6 for secretion of soluble cargos. Transport of transmembrane cargos to the plasma membrane was also significantly delayed in Rab6-KO cells, but the phenotype was relatively mild.
    [Show full text]
  • Small Rab Gtpases in Intracellular Vesicle Trafficking:The Case Of
    International Journal of Molecular Sciences Review Small Rab GTPases in Intracellular Vesicle Trafficking: The Case of Rab3A/Raphillin-3A Complex in the Kidney Olga Martinez-Arroyo 1,† , Estela Selma-Soriano 2,†, Ana Ortega 1,* , Raquel Cortes 1,‡ and Josep Redon 1,3,*,‡ 1 Cardiometabolic and Renal Risk Research Group, INCLIVA Biomedical Research Institute, 46010 Valencia, Spain; [email protected] (O.M.-A.); [email protected] (R.C.) 2 Physiopathology of Cellular and Organic Oxidative Stress Group, University of Valencia, 46100 Valencia, Spain; [email protected] 3 CIBERObn, Carlos III Institute, 28029 Madrid, Spain * Correspondence: [email protected] (A.O.); [email protected] (J.R.); Tel.: +34-658-909-676 (A.O. & J.R.) † These authors contributed equally as first authors to this work. ‡ These authors contributed equally as senior authors to this work. Abstract: Small Rab GTPases, the largest group of small monomeric GTPases, regulate vesicle traf- ficking in cells, which are integral to many cellular processes. Their role in neurological diseases, such as cancer and inflammation have been extensively studied, but their implication in kidney disease has not been researched in depth. Rab3a and its effector Rabphillin-3A (Rph3A) expression have been demonstrated to be present in the podocytes of normal kidneys of mice rats and humans, around vesicles contained in the foot processes, and they are overexpressed in diseases with proteinuria. In addition, the Rab3A knockout mice model induced profound cytoskeletal changes in podocytes of high glucose fed animals. Likewise, RphA interference in the Drosophila model produced structural Citation: Martinez-Arroyo, O.; and functional damage in nephrocytes with reduction in filtration capacities and nephrocyte number.
    [Show full text]
  • Supporting Information
    Supporting Information Hunter et al. 10.1073/pnas.1404639111 SI Methods and no additional magnesium. SML was added to a concentra- Protein Expression and Purification. A construct encoding codon- tion of 150 μM, and GTP and GDP were added to a concentra- optimized N-terminal His-tobacco etch virus (TEV)-G12C V-Ki- tion of 1.5 mM each in the respective samples. Samples were ras2 Kirsten rat sarcoma viral oncogene homolog (K-Ras) in the incubated at 37 °C for the indicated length of time. For each time pJExpressvector(DNA2.0)wassynthesized and used to transform point, 27 μL of sample was mixed with 3 μL of 7-diethylamino- BL21(DE3) cells. Cells were grown in Luria broth (LB) to OD 600 3-(4-maleimidophenyl)-4-methylcoumarin dissolved in DMSO 0.7 and induced with 250 mM isopropyl β-D-1-thiogalactopyrano- (100 μM final concentration) in a black 384-well plate and side (IPTG) for 16 h at 16 °C. Cells were pelleted and resuspended fluorescence was read at 384/470 nm. The assay was run in in lysis buffer [20 mM sodium phosphate (pH 8.0), 500 mM NaCl, triplicate, and normalized data were fit to a one-phase decay 10 mM imidazole, 1 mM 2-mercaptoethanol (BME), 5% (vol/vol) nonlinear regression curve in GraphPad Prism. glycerol] containing PMSF, benzamidine, and 1 mg/mL lysozyme. Lysates were flash-frozen and stored at −80 °C until use. Sequence Conservation Analysis. AminoacidsequencesofRas Protein was purified over an IMAC cartridge (BioRad) fol- family proteins were obtained from the National Center for lowing standard Ni-affinity protocols and desalted into 1× crys- Biotechnology Information Protein Data Bank (PDB) and tallization buffer [20 mM Hepes (pH 8.0), 150 mM NaCl, 5 mM aligned using the multiple alignment server, Clustal-Omega (v.1.2.0).
    [Show full text]
  • Autocrine IFN Signaling Inducing Profibrotic Fibroblast Responses By
    Downloaded from http://www.jimmunol.org/ by guest on September 23, 2021 Inducing is online at: average * The Journal of Immunology , 11 of which you can access for free at: 2013; 191:2956-2966; Prepublished online 16 from submission to initial decision 4 weeks from acceptance to publication August 2013; doi: 10.4049/jimmunol.1300376 http://www.jimmunol.org/content/191/6/2956 A Synthetic TLR3 Ligand Mitigates Profibrotic Fibroblast Responses by Autocrine IFN Signaling Feng Fang, Kohtaro Ooka, Xiaoyong Sun, Ruchi Shah, Swati Bhattacharyya, Jun Wei and John Varga J Immunol cites 49 articles Submit online. Every submission reviewed by practicing scientists ? is published twice each month by Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts http://jimmunol.org/subscription Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html http://www.jimmunol.org/content/suppl/2013/08/20/jimmunol.130037 6.DC1 This article http://www.jimmunol.org/content/191/6/2956.full#ref-list-1 Information about subscribing to The JI No Triage! Fast Publication! Rapid Reviews! 30 days* Why • • • Material References Permissions Email Alerts Subscription Supplementary The Journal of Immunology The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2013 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. This information is current as of September 23, 2021. The Journal of Immunology A Synthetic TLR3 Ligand Mitigates Profibrotic Fibroblast Responses by Inducing Autocrine IFN Signaling Feng Fang,* Kohtaro Ooka,* Xiaoyong Sun,† Ruchi Shah,* Swati Bhattacharyya,* Jun Wei,* and John Varga* Activation of TLR3 by exogenous microbial ligands or endogenous injury-associated ligands leads to production of type I IFN.
    [Show full text]
  • A Meta-Analysis of the Effects of High-LET Ionizing Radiations in Human Gene Expression
    Supplementary Materials A Meta-Analysis of the Effects of High-LET Ionizing Radiations in Human Gene Expression Table S1. Statistically significant DEGs (Adj. p-value < 0.01) derived from meta-analysis for samples irradiated with high doses of HZE particles, collected 6-24 h post-IR not common with any other meta- analysis group. This meta-analysis group consists of 3 DEG lists obtained from DGEA, using a total of 11 control and 11 irradiated samples [Data Series: E-MTAB-5761 and E-MTAB-5754]. Ensembl ID Gene Symbol Gene Description Up-Regulated Genes ↑ (2425) ENSG00000000938 FGR FGR proto-oncogene, Src family tyrosine kinase ENSG00000001036 FUCA2 alpha-L-fucosidase 2 ENSG00000001084 GCLC glutamate-cysteine ligase catalytic subunit ENSG00000001631 KRIT1 KRIT1 ankyrin repeat containing ENSG00000002079 MYH16 myosin heavy chain 16 pseudogene ENSG00000002587 HS3ST1 heparan sulfate-glucosamine 3-sulfotransferase 1 ENSG00000003056 M6PR mannose-6-phosphate receptor, cation dependent ENSG00000004059 ARF5 ADP ribosylation factor 5 ENSG00000004777 ARHGAP33 Rho GTPase activating protein 33 ENSG00000004799 PDK4 pyruvate dehydrogenase kinase 4 ENSG00000004848 ARX aristaless related homeobox ENSG00000005022 SLC25A5 solute carrier family 25 member 5 ENSG00000005108 THSD7A thrombospondin type 1 domain containing 7A ENSG00000005194 CIAPIN1 cytokine induced apoptosis inhibitor 1 ENSG00000005381 MPO myeloperoxidase ENSG00000005486 RHBDD2 rhomboid domain containing 2 ENSG00000005884 ITGA3 integrin subunit alpha 3 ENSG00000006016 CRLF1 cytokine receptor like
    [Show full text]