Contribution of Programmed Cell Death 6 Genetic Variations, Gender, and Smoking Status to Lung Cancer

Total Page:16

File Type:pdf, Size:1020Kb

Load more

OncoTargets and Therapy Dovepress open access to scientific and medical research Open Access Full Text Article ORIGINAL RESEARCH Contribution of programmed cell death 6 genetic variations, gender, and smoking status to lung cancer This article was published in the following Dove Press journal: OncoTargets and Therapy – Te-Chun Shen1 3,* Purpose: Programmed cell death 6 (PDCD6) is a calcium sensor participating in T-cell Wen-Shin Chang1,2,* receptor-, Fas-, and glucocorticoid-induced programmed cell death. At the sites of lung Te-Chun Hsia1,3,4,* tumors, the expression of PDCD6 is higher than that in non-tumor tissues. However, the Hsin-Ting Li1 contribution of variant PDCD6 genotypes to lung cancer is largely unknown. The current Wei-Chun Chen3,4 study aimed to evaluate the contributions of the PDCD6 rs4957014 and rs3756712 genotypes to the risk of lung cancer. Chia-Wen Tsai1,* Patients and methods: The contributions of PDCD6 genotypes to lung cancer risk were Da-Tian Bau1,2,5,* examined among 358 patients with lung cancer and 716 age- and gender-matched healthy 1Terry Fox Cancer Research Laboratory, controls by typical polymerase chain reaction-restriction fragment length polymorphism Translational Medicine Research Center, (PCR-RFLP) methodology. China Medical University Hospital, Taichung, Taiwan; 2Graduate Institute of Results: The results showed that the GG but not the GT genotype of PDCD6 rs4957014 was Clinical Medical Science, China Medical associated with a decreased risk of lung cancer (odds ratio (OR) =0.41, 95% confidence University, Taichung, Taiwan; – 3Department of Internal Medicine, China interval (CI) =0.23 0.72, p=0.0013). The analysis of allelic frequency distributions showed Medical University Hospital, Taichung, that the G allele of PDCD6 rs4957014 decreased lung cancer susceptibility (p=0.0090). 4 Taiwan; Department of Respiratory There was no association between PDCD6 rs3756712 genotypes and lung cancer risk. Therapy, China Medical University, fi Taichung, Taiwan; 5Department of Interestingly, the GG genotype at PDCD6 rs4957014 signi cantly decreased the risk of Bioinformatics and Medical Engineering, lung cancer among males (adjusted OR =0.29, 95% CI =0.14–0.57) and smokers (adjusted Asia University, Taichung, Taiwan OR =0.34, 95% CI =0.18–0.61) but not among females and non-smokers. *These authors contributed equally to Conclusion: The GG genotype of PDCD6 rs4957014 may decrease lung cancer risk in this work males and smokers and may serve as a practical marker for early detection and the incidence of lung cancer in Taiwan. Keywords: genotype, lung cancer, male, programmed cell death 6 (PDCD6), polymorphism, smoking Introduction For decades, lung cancer has been the most commonly diagnosed cancer and the leading cause of cancer death all over the world.1–3 Although several anticancer therapeutic strategies and technologies are rapidly being developed, the prognosis of Correspondence: Da-Tian Bau; Chia-Wen lung cancer patients remains very poor, as the overall 5-year survival rates are still less Tsai 4,5 Terry Fox Cancer Research Laboratory, than 15–20%. From an epidemiological viewpoint, the most commonly identified Translational Medicine Research Center, factor in lung development and carcinogenesis is believed to be the individual’s long- China Medical University Hospital, 2 Yuh-Der Road, Taichung 404, Taiwan term history of tobacco consumption, which is also a useful predictor of poor Tel +886 42 205 3366 (Ext. 5805) prognosis.6–8 In this decade, many case-control studies have reported that specific Email [email protected]; [email protected] genotypes are associated with higher lung cancer risk for cigarette smokers than for submit your manuscript | www.dovepress.com OncoTargets and Therapy 2019:12 6237–6244 6237 DovePress © 2019 Shen et al. This work is published and licensed by Dove Medical Press Limited. The full terms of this license are available at https://www.dovepress.com/terms.php and incorporate the Creative Commons Attribution – Non Commercial (unported, v3.0) License (http://creativecommons.org/licenses/by-nc/3.0/). By accessing the work http://doi.org/10.2147/OTT.S205544 you hereby accept the Terms. Non-commercial uses of the work are permitted without any further permission from Dove Medical Press Limited, provided the work is properly attributed. For permission for commercial use of this work, please see paragraphs 4.2 and 5 of our Terms (https://www.dovepress.com/terms.php). Shen et al Dovepress non-smokers9–17 and vice versa.18–21 In 2010, Lissowska and Medical University Hospital. The clinical characteristics of colleagues conducted a meta-analysis of 41 global studies these lung cancer patients, including their histological details, and proposed that family lung cancer history, although often were all graded and definedbywell-traineddoctors.The not well recorded, is a risk factor for lung cancer.22 The exclusion criteria were history of any other cancer or pulmon- above studies elucidating the gene-lifestyle interactions in ary disease, such as chronic obstructive pulmonary disease, lung cancer risk, with or without attention to smoking status, pneumothorax, and asthma. Simultaneously, 716 healthy may provide not only predictive markers for revealing the volunteers without lung cancer for every case were chosen personalized etiology of lung cancer but also potential targets as controls by matching for age, gender, and smoking behavior for personalized therapy and genomic pharmacology. after initial random sampling from the Health Examination The PDCD6 gene, also known as apoptosis-linked gene 2 Cohort of China Medical University Hospital. The exclusion (ALG- 2), is located on human chromosome 5p15.33 and criteria of the controls included previous malignancy, metas- encodes the 22-kD programmed cell death protein 6.23,24 tasized cancer from another or an unknown origin, and any PDCD6 is a Ca2+-binding protein capable of interacting with genetic or familial diseases. All participants in this project Alix/AIP1 and their orthologs,25 ASK1,26 and Sec31A,27 so as voluntarily completed a self-administered questionnaire and to participate in T-cell receptor-, Fas-, glucocorticoid-, and ER provided a 5-ml sample of peripheral blood for genotyping. stress-induced apoptosis.23,28 In a knockout animal model, The study was conducted in accordance with the Declaration PDCD6-deficient mice were developmentally and immunolo- of Helsinki and approved by the Institutional Review Board of gically normal, indicating that PDCD6 is not essential for the China Medical University Hospital with the document physical development or immune function.29 However, coded DMR100-IRB-284. Written informed consent was PDCD6-deficient cells were no longer capable of blocking obtained from each participant with the help of the tissue apoptosis induced by TCR, FAS, or dexamethasone signals.29 bank. Typical characteristics of the subjects included in this The expression levels and genotypes30 of PDCD6 are asso- study are summarized in Table 1. ciated with cancer risk. In 2003, it was found that PDCD6 was upregulated at tumor sites relative to non-tumor sites among Methodology for PDCD6 genotyping lung cancer patients.31 With respect to lung cancer genomics, Genomic DNA from peripheral blood leucocytes of each only one paper has investigated the association of PDCD6 subject was extracted with a QIAamp Blood Mini Kit genotypes with lung cancer risk.32 In that study, the T allele of (Blossom, Taipei, Taiwan) and further stored and processed rs3756712 G/T, but not that of rs4957014 G/T, was found to be as previously described.16,17 Briefly, the polymerase chain associated with an increased risk of lung cancer.32 However, reaction (PCR) cycling programs set for PDCD6 genotypes the positive findings reported by them should be validated by were the following: one cycle at 94 °C for 5 min; 35 cycles of other studies, especially those conducted in Asian populations. 94 °C for 30 s, 55 °C for 30 s and 72 °C for 30 s; and a final Thus, in the present study, we aimed to investigate the con- extension at 72 °C for 10 min. The DNA sequences of the tribution of PDCD6 genotypes at rs3756712 G/T and forward and reverse primers for PDCD6 rs4957014 were 5′- rs4957014 G/T single-nucleotide polymorphic sites to the TGGTGTTTCATACCATTGACACTTGC-3′ and 5′- risk of lung cancer and then to examine the joint effect of CTCAGAACCAAGCAGGTTCCTTCA-3′,respectively. environmental factors, such as habitual smoking, and PDCD6 As for PDCD6 rs3756712, the DNA sequences of the for- genotypes on lung cancer risk in Taiwan. ward and reverse primers were 5′- TACAGTGGCAAAG GACCACA-3′ and 5′-CACATTCCAGCACTCACCAC-3′, respectively. Following PCR amplification, the products of Materials and methods PDCD6 rs4957014 and rs3756712 were subject to restriction Methodology for population data collection enzyme digestion with HphI and RsaI (New England First, we have evaluated the sample size for the study group BioLabs, Ipswich, MA, USA), respectively. As for PDCD6 and the estimated total sample size was 864 (432 in each rs4957014, the digestible G allele was cut into 113- and group) while alpha =5%, power =80%, the proportion of 13-base pair contigs, while the indigestible T allele was left homozygous mutant in the case group =10%, and the differ- intact as a 126-base pair long contig. As for PDCD6 ence =5%. From 2005 to 2008, data on 358 patients diagnosed rs3756712, the digestible G allele was cut into 113- and 13- with lung cancer were collected by the surgery team led
Recommended publications
  • Farnesol-Induced Apoptosis in Human Lung Carcinoma Cells Is Coupled to the Endoplasmic Reticulum Stress Response

    Farnesol-Induced Apoptosis in Human Lung Carcinoma Cells Is Coupled to the Endoplasmic Reticulum Stress Response

    Research Article Farnesol-Induced Apoptosis in Human Lung Carcinoma Cells Is Coupled to the Endoplasmic Reticulum Stress Response Joung Hyuck Joo,1 Grace Liao,1 Jennifer B. Collins,2 Sherry F. Grissom,2 and Anton M. Jetten1 1Cell Biology Section, LRB, and 2Microarray Group, Division of Intramural Research, National Institute of Environmental Health Sciences, NIH, Research Triangle Park, North Carolina Abstract range of fruits and vegetables (9, 10). Each isoprenoid has been Farnesol (FOH) and other isoprenoid alcohols induce apopto- shown to inhibit proliferation and induce apoptosis in a number of sis in various carcinoma cells and inhibit tumorigenesis in neoplastic cell lines from different origins (4, 11–14). In addition, in vivo these isoprenoids have been reported to be effective in chemo- several models. However, the mechanisms by which in vivo they mediate their effects are not yet fully understood. In this prevention and chemotherapy in various cancer models study, we show that FOH is an effective inducer of apoptosis in (10, 12, 15, 16). FOH has been reported to exhibit chemopreventive several lung carcinoma cells, including H460. This induction is effects in colon and pancreas carcinogenesis in rats (9, 17) whereas associated with activation of several caspases and cleavage of phase I and II clinical trials have indicated therapeutic potential poly(ADP-ribose) polymerase (PARP). To obtain insight into for POH (16, 18). The mechanisms by which these isoprenoids induce these effects are not yet fully understood. Isoprenoids have the mechanism involved in FOH-induced apoptosis, we compared the gene expression profiles of FOH-treated and been reported to inhibit posttranslational protein prenylation (19) control H460 cells by microarray analysis.
  • Multi-Targeted Mechanisms Underlying the Endothelial Protective Effects of the Diabetic-Safe Sweetener Erythritol

    Multi-Targeted Mechanisms Underlying the Endothelial Protective Effects of the Diabetic-Safe Sweetener Erythritol

    Multi-Targeted Mechanisms Underlying the Endothelial Protective Effects of the Diabetic-Safe Sweetener Erythritol Danie¨lle M. P. H. J. Boesten1*., Alvin Berger2.¤, Peter de Cock3, Hua Dong4, Bruce D. Hammock4, Gertjan J. M. den Hartog1, Aalt Bast1 1 Department of Toxicology, Maastricht University, Maastricht, The Netherlands, 2 Global Food Research, Cargill, Wayzata, Minnesota, United States of America, 3 Cargill RandD Center Europe, Vilvoorde, Belgium, 4 Department of Entomology and UCD Comprehensive Cancer Center, University of California Davis, Davis, California, United States of America Abstract Diabetes is characterized by hyperglycemia and development of vascular pathology. Endothelial cell dysfunction is a starting point for pathogenesis of vascular complications in diabetes. We previously showed the polyol erythritol to be a hydroxyl radical scavenger preventing endothelial cell dysfunction onset in diabetic rats. To unravel mechanisms, other than scavenging of radicals, by which erythritol mediates this protective effect, we evaluated effects of erythritol in endothelial cells exposed to normal (7 mM) and high glucose (30 mM) or diabetic stressors (e.g. SIN-1) using targeted and transcriptomic approaches. This study demonstrates that erythritol (i.e. under non-diabetic conditions) has minimal effects on endothelial cells. However, under hyperglycemic conditions erythritol protected endothelial cells against cell death induced by diabetic stressors (i.e. high glucose and peroxynitrite). Also a number of harmful effects caused by high glucose, e.g. increased nitric oxide release, are reversed. Additionally, total transcriptome analysis indicated that biological processes which are differentially regulated due to high glucose are corrected by erythritol. We conclude that erythritol protects endothelial cells during high glucose conditions via effects on multiple targets.
  • 1 Supporting Information for a Microrna Network Regulates

    1 Supporting Information for a Microrna Network Regulates

    Supporting Information for A microRNA Network Regulates Expression and Biosynthesis of CFTR and CFTR-ΔF508 Shyam Ramachandrana,b, Philip H. Karpc, Peng Jiangc, Lynda S. Ostedgaardc, Amy E. Walza, John T. Fishere, Shaf Keshavjeeh, Kim A. Lennoxi, Ashley M. Jacobii, Scott D. Rosei, Mark A. Behlkei, Michael J. Welshb,c,d,g, Yi Xingb,c,f, Paul B. McCray Jr.a,b,c Author Affiliations: Department of Pediatricsa, Interdisciplinary Program in Geneticsb, Departments of Internal Medicinec, Molecular Physiology and Biophysicsd, Anatomy and Cell Biologye, Biomedical Engineeringf, Howard Hughes Medical Instituteg, Carver College of Medicine, University of Iowa, Iowa City, IA-52242 Division of Thoracic Surgeryh, Toronto General Hospital, University Health Network, University of Toronto, Toronto, Canada-M5G 2C4 Integrated DNA Technologiesi, Coralville, IA-52241 To whom correspondence should be addressed: Email: [email protected] (M.J.W.); yi- [email protected] (Y.X.); Email: [email protected] (P.B.M.) This PDF file includes: Materials and Methods References Fig. S1. miR-138 regulates SIN3A in a dose-dependent and site-specific manner. Fig. S2. miR-138 regulates endogenous SIN3A protein expression. Fig. S3. miR-138 regulates endogenous CFTR protein expression in Calu-3 cells. Fig. S4. miR-138 regulates endogenous CFTR protein expression in primary human airway epithelia. Fig. S5. miR-138 regulates CFTR expression in HeLa cells. Fig. S6. miR-138 regulates CFTR expression in HEK293T cells. Fig. S7. HeLa cells exhibit CFTR channel activity. Fig. S8. miR-138 improves CFTR processing. Fig. S9. miR-138 improves CFTR-ΔF508 processing. Fig. S10. SIN3A inhibition yields partial rescue of Cl- transport in CF epithelia.
  • Downloaded from URL: Δ Δ Nated ALG-2 GF122) and GST-ALG-2 GF122 Was Cium.Uhnres.Utoronto.Ca/Vgm

    Downloaded from URL: Δ Δ Nated ALG-2 GF122) and GST-ALG-2 GF122 Was Cium.Uhnres.Utoronto.Ca/Vgm

    Inuzuka et al. BMC Structural Biology 2010, 10:25 http://www.biomedcentral.com/1472-6807/10/25 RESEARCH ARTICLE Open Access Molecular basis for defect in Alix-binding by alternatively spliced isoform of ALG-2 (ALG-2ΔGF122) and structural roles of F122 in target recognition Tatsutoshi Inuzuka1, Hironori Suzuki1,2, Masato Kawasaki2, Hideki Shibata1, Soichi Wakatsuki2, Masatoshi Maki1* Abstract Background: ALG-2 (a gene product of PDCD6) belongs to the penta-EF-hand (PEF) protein family and Ca2 +-dependently interacts with various intracellular proteins including mammalian Alix, an adaptor protein in the ESCRT system. Our previous X-ray crystal structural analyses revealed that binding of Ca2+ to EF3 enables the side chain of R125 to move enough to make a primary hydrophobic pocket (Pocket 1) accessible to a short fragment of Alix. The side chain of F122, facing a secondary hydrophobic pocket (Pocket 2), interacts with the Alix peptide. An alternatively spliced shorter isoform, designated ALG-2ΔGF122, lacks Gly121Phe122 and does not bind Alix, but the structural basis of the incompetence has remained to be elucidated. Results: We solved the X-ray crystal structure of the PEF domain of ALG-2ΔGF122 in the Ca2+-bound form and compared it with that of ALG-2. Deletion of the two residues shortened a-helix 5 (a5) and changed the configuration of the R125 side chain so that it partially blocked Pocket 1. A wall created by the main chain of 121- GFG-123 and facing the two pockets was destroyed. Surprisingly, however, substitution of F122 with Ala or Gly, but not with Trp, increased the Alix-binding capacity in binding assays.
  • PDCD6 Antibody Order 021-34695924 Orders@Ab-Mart.Com Support 400-6123-828 50Ul Support1@Ab-Mart.Com 100 Ul √ √ Web

    PDCD6 Antibody Order 021-34695924 [email protected] Support 400-6123-828 50Ul [email protected] 100 Ul √ √ Web

    TD7978 PDCD6 Antibody Order 021-34695924 [email protected] Support 400-6123-828 50ul [email protected] 100 uL √ √ Web www.ab-mart.com.cn Description: Calcium sensor that plays a key role in processes such as endoplasmic reticulum (ER)- Golgi vesicular transport, endosomal biogenesis or membrane repair. Acts as an adapter that bridges unrelated proteins or stabilizes weak protein-protein complexes in response to calcium: calcium-binding triggers exposure of apolar surface, promoting interaction with different sets of proteins thanks to 3 different hydrophobic pockets, leading to translocation to membranes. Involved in ER-Golgi transport by promoting the association between PDCD6IP and TSG101, thereby bridging together the ESCRT-III and ESCRT-I complexes. Together with PEF1, acts as calcium-dependent adapter for the BCR(KLHL12) complex, a complex involved in ER-Golgi transport by regulating the size of COPII coats. In response to cytosolic calcium increase, the heterodimer formed with PEF1 interacts with, and bridges together the BCR(KLHL12) complex and SEC31 (SEC31A or SEC31B), promoting monoubiquitination of SEC31 and subsequent collagen export, which is required for neural crest specification. Involved in the regulation of the distribution and function of MCOLN1 in the endosomal pathway. Promotes localization and polymerization of TFG at endoplasmic reticulum exit site. Required for T-cell receptor-, Fas-, and glucocorticoid- induced apoptosis (By similarity). May mediate Ca(2+)-regulated signals along the death pathway: interaction with DAPK1 can accelerate apoptotic cell death by increasing caspase-3 activity. Its role in apoptosis may however be indirect, as suggested by knockout experiments (By similarity). May inhibit KDR/VEGFR2-dependent angiogenesis; the function involves inhibition of VEGF-induced phosphorylation of the Akt signaling pathway.
  • PDCD6IP (Human) Recombinant Protein (P01)

    PDCD6IP (Human) Recombinant Protein (P01)

    PDCD6IP (Human) Recombinant Preparation Method: in vitro wheat germ expression Protein (P01) system Purification: Glutathione Sepharose 4 Fast Flow Catalog Number: H00010015-P01 Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Regulation Status: For research use only (RUO) Glutathione, pH=8.0 in the elution buffer. Product Description: Human PDCD6IP full-length ORF Storage Instruction: Store at -80°C. Aliquot to avoid ( AAH20066, 1 a.a. - 868 a.a.) recombinant protein with repeated freezing and thawing. GST-tag at N-terminal. Entrez GeneID: 10015 Sequence: MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQ Gene Symbol: PDCD6IP YCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQIC SIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALA Gene Alias: AIP1, Alix, DRIP4, HP95, MGC17003 SLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKH YQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIM Gene Summary: This gene encodes a protein thought LAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFK to participate in programmed cell death. Studies using QCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQ mouse cells have shown that overexpression of this QKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKI protein can block apoptosis. In addition, the product of NRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTP this gene binds to the product of the PDCD6 gene, a VNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVN protein required for apoptosis, in a calcium-dependent RSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSIL manner. This gene product also binds to endophilins, TKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLL proteins that regulate membrane shape during DEEEATDNDLRAKFKERWQRTPSNELYKPLRAEGTNF endocytosis.
  • Anti-PEF1 / Peflin Antibody (ARG42993)

    Anti-PEF1 / Peflin Antibody (ARG42993)

    Product datasheet [email protected] ARG42993 Package: 100 μl anti-PEF1 / Peflin antibody Store at: -20°C Summary Product Description Rabbit Polyclonal antibody recognizes PEF1 / Peflin Tested Reactivity Hu, Ms, Rat Tested Application FACS, WB Host Rabbit Clonality Polyclonal Isotype IgG Target Name PEF1 / Peflin Antigen Species Human Immunogen Synthetic peptide of Human PEF1 / Peflin. Conjugation Un-conjugated Alternate Names ABP32; PEF1A; Peflin; PEF protein with a long N-terminal hydrophobic domain; Penta-EF hand domain- containing protein 1 Application Instructions Application table Application Dilution FACS 1:20 WB 1:1000 - 1:5000 Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. Positive Control K562 Calculated Mw 30 kDa Observed Size ~ 31 kDa Properties Form Liquid Purification Affinity purified. Buffer 50 nM Tris-Glycine (pH 7.4), 0.15M NaCl, 0.01% Sodium azide, 40% Glycerol and 0.05% BSA. Preservative 0.01% Sodium azide Stabilizer 40% Glycerol and 0.05% BSA Storage instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. www.arigobio.com 1/2 Note For laboratory research only, not for drug, diagnostic or other use. Bioinformation Gene Symbol PEF1 Gene Full Name penta-EF-hand domain containing 1 Background This gene encodes a calcium-binding protein belonging to the penta-EF-hand protein family.
  • Characterizing the Chlamydia Trachomatis Inclusion Membrane Proteome

    Characterizing the Chlamydia Trachomatis Inclusion Membrane Proteome

    Characterizing the Chlamydia trachomatis inclusion membrane proteome Mary Dickinson A dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy University of Washington 2019 Reading committee Kevin Hybiske, Chair Lee Ann Campbell David Sherman Program Authorized to Offer Degree: Pathobiology ©Copyright 2019 Mary Dickinson ii University of Washington Abstract Characterizing the Chlamydia trachomatis inclusion membrane proteome Mary Dickinson Chair of the Supervisory Committee: Kevin Hybiske Pathobiology Program, Department of Medicine Chlamydia trachomatis is the most common cause of bacterial sexually transmitted infection, responsible for millions of infections each year. Despite this high prevalence, the elucidation of the molecular mechanisms of Chlamydia pathogenesis has been difficult due to limitations in genetic tools and its intracellular developmental cycle. Within a host epithelial cell, chlamydiae replicate within a vacuole called the inclusion. Many Chlamydia–host interactions are thought to be mediated by the Inc family of type III secreted proteins that are anchored in the inclusion membrane, but their array of host targets are largely unknown. To investigate how the inclusion membrane proteome changes over the course of an infected cell, we have adapted the APEX system of proximity-dependent biotinylation. APEX is capable of specifically labeling proteins within a 20 nm radius in living cells. We transformed C. trachomatis to express the enzyme APEX fused to known inclusion membrane proteins, allowing biotinylation and purification of inclusion-associated proteins. Using quantitative mass spectrometry against APEX labeled samples, we identified over 400 proteins associated with the inclusion membrane at early, middle, and late stages of epithelial cell infection. This system was iii sensitive enough to detect inclusion interacting proteins early in the developmental cycle, at 8 hours post infection, a previously intractable time point.
  • Functional Dependency Analysis Identifies Potential Druggable

    Functional Dependency Analysis Identifies Potential Druggable

    cancers Article Functional Dependency Analysis Identifies Potential Druggable Targets in Acute Myeloid Leukemia 1, 1, 2 3 Yujia Zhou y , Gregory P. Takacs y , Jatinder K. Lamba , Christopher Vulpe and Christopher R. Cogle 1,* 1 Division of Hematology and Oncology, Department of Medicine, College of Medicine, University of Florida, Gainesville, FL 32610-0278, USA; yzhou1996@ufl.edu (Y.Z.); gtakacs@ufl.edu (G.P.T.) 2 Department of Pharmacotherapy and Translational Research, College of Pharmacy, University of Florida, Gainesville, FL 32610-0278, USA; [email protected]fl.edu 3 Department of Physiological Sciences, College of Veterinary Medicine, University of Florida, Gainesville, FL 32610-0278, USA; cvulpe@ufl.edu * Correspondence: [email protected]fl.edu; Tel.: +1-(352)-273-7493; Fax: +1-(352)-273-5006 Authors contributed equally. y Received: 3 November 2020; Accepted: 7 December 2020; Published: 10 December 2020 Simple Summary: New drugs are needed for treating acute myeloid leukemia (AML). We analyzed data from genome-edited leukemia cells to identify druggable targets. These targets were necessary for AML cell survival and had favorable binding sites for drug development. Two lists of genes are provided for target validation, drug discovery, and drug development. The deKO list contains gene-targets with existing compounds in development. The disKO list contains gene-targets without existing compounds yet and represent novel targets for drug discovery. Abstract: Refractory disease is a major challenge in treating patients with acute myeloid leukemia (AML). Whereas the armamentarium has expanded in the past few years for treating AML, long-term survival outcomes have yet to be proven. To further expand the arsenal for treating AML, we searched for druggable gene targets in AML by analyzing screening data from a lentiviral-based genome-wide pooled CRISPR-Cas9 library and gene knockout (KO) dependency scores in 15 AML cell lines (HEL, MV411, OCIAML2, THP1, NOMO1, EOL1, KASUMI1, NB4, OCIAML3, MOLM13, TF1, U937, F36P, AML193, P31FUJ).
  • ALIX / PDCD6IP Antibody Cat

    ALIX / PDCD6IP Antibody Cat

    ALIX / PDCD6IP Antibody Cat. No.: 18-578 ALIX / PDCD6IP Antibody Immunohistochemistry of paraffin- embedded rat kidney using ALIX / Immunohistochemistry of paraffin-embedded human prostate using ALIX / PDCD6IP antibody (18-578) at PDCD6IP antibody (18-578) at dilution of 1:100 (40x lens). dilution of 1:100 (40x lens). Immunohistochemistry of paraffin- embedded human stomach using ALIX / PDCD6IP antibody (18-578) at dilution of 1:100 (40x lens). Specifications HOST SPECIES: Rabbit September 24, 2021 1 https://www.prosci-inc.com/alix-pdcd6ip-antibody-18-578.html SPECIES REACTIVITY: Human, Mouse, Rat Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of IMMUNOGEN: human ALIX / PDCD6IP (NP_037506.2). TESTED APPLICATIONS: IHC, WB WB: ,1:200 - 1:2000 APPLICATIONS: IHC: ,1:50 - 1:200 POSITIVE CONTROL: 1) HeLa 2) LO2 3) Jurkat 4) Rat brain PREDICTED MOLECULAR Observed: 105kDa WEIGHT: Properties PURIFICATION: Affinity purification CLONALITY: Polyclonal ISOTYPE: IgG CONJUGATE: Unconjugated PHYSICAL STATE: Liquid BUFFER: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. STORAGE CONDITIONS: Store at -20˚C. Avoid freeze / thaw cycles. Additional Info OFFICIAL SYMBOL: PDCD6IP Programmed cell death 6-interacting protein, PDCD6-interacting protein, ALG-2- ALTERNATE NAMES: interacting protein 1, ALG-2-interacting protein X, Hp95, PDCD6IP, AIP1, ALIX, KIAA1375 GENE ID: 10015 USER NOTE: Optimal dilutions for each application to be determined by the researcher. Background and References September 24, 2021 2 https://www.prosci-inc.com/alix-pdcd6ip-antibody-18-578.html This gene encodes a protein that functions within the ESCRT pathway in the abscission stage of cytokinesis, in intralumenal endosomal vesicle formation, and in enveloped virus budding.
  • Atlas Journal

    Atlas Journal

    Atlas of Genetics and Cytogenetics in Oncology and Haematology Home Genes Leukemias Solid Tumours Cancer-Prone Deep Insight Portal Teaching X Y 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 NA Atlas Journal Atlas Journal versus Atlas Database: the accumulation of the issues of the Journal constitutes the body of the Database/Text-Book. TABLE OF CONTENTS Volume 12, Number 5, Sep-Oct 2008 Previous Issue / Next Issue Genes XAF1 (XIAP associated factor-1) (17p13.2). Stéphanie Plenchette, Wai Gin Fong, Robert G Korneluk. Atlas Genet Cytogenet Oncol Haematol 2008; 12 (5): 668-673. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/XAF1ID44095ch17p13.html WWP1 (WW domain containing E3 ubiquitin protein ligase 1) (8q21.3). Ceshi Chen. Atlas Genet Cytogenet Oncol Haematol 2008; 12 (5): 674-680. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/WWP1ID42993ch8q21.html TSPAN1 (tetraspanin 1) (1p34.1). David Murray, Peter Doran. Atlas Genet Cytogenet Oncol Haematol 2008; 12 (5): 681-683. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/TSPAN1ID44178ch1p34.html TCL1B (T-cell leukemia/lymphoma 1B) (14q32.13). Herbert Eradat, Michael A Teitell. Atlas Genet Cytogenet Oncol Haematol 2008; 12 (5): 684-686. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/TCL1BID354ch14q32.html PVRL4 (poliovirus receptor-related 4) (1q23.3). Marc Lopez. Atlas Genet Cytogenet Oncol Haematol 2008; 12 (5): 687-690. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/PVRL4ID44141ch1q23.html PTTG1IP (pituitary tumor-transforming 1 interacting protein) (21q22.3). Vicki Smith, Chris McCabe. Atlas Genet Cytogenet Oncol Haematol 2008; 12 (5): 691-694.
  • PDCD6 Antibody (Center) Purified Rabbit Polyclonal Antibody (Pab) Catalog # Ap20782c

    PDCD6 Antibody (Center) Purified Rabbit Polyclonal Antibody (Pab) Catalog # Ap20782c

    10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 PDCD6 Antibody (Center) Purified Rabbit Polyclonal Antibody (Pab) Catalog # AP20782c Specification PDCD6 Antibody (Center) - Product Information Application WB,E Primary Accession O75340 Other Accession P12815 Reactivity Mouse Host Rabbit Clonality Polyclonal Isotype Rabbit Ig Calculated MW 21868 PDCD6 Antibody (Center) - Additional Information Gene ID 10016 Other Names Programmed cell death protein 6, Apoptosis-linked gene 2 protein, Probable Western blot analysis of lysate from mouse calcium-binding protein ALG-2, PDCD6, liver tissue lysate, using PDCD6 Antibody ALG2 (Center)(Cat. #AP20782c). AP20782c was diluted at 1:1000. A goat anti-rabbit IgG Target/Specificity H&L(HRP) at 1:5000 dilution was used as the This PDCD6 antibody is generated from a secondary antibody. Lysate at 35ug. rabbit immunized with a KLH conjugated synthetic peptide between 103-137 amino acids from the Central region of human PDCD6 Antibody (Center) - Background PDCD6. Calcium-binding protein required for T-cell Dilution receptor-, Fas-, and glucocorticoid-induced cell WB~~1:1000 death. May mediate Ca(2+)- regulated signals along the death pathway (By similarity). Format Purified polyclonal antibody supplied in PBS Calcium-dependent adapter necessary for the with 0.09% (W/V) sodium azide. This association between PDCD6IP and TSG101. antibody is purified through a protein A Interaction with DAPK1 can accelerate column, followed by peptide affinity apoptotic cell death by increasing caspase-3 purification. activity. May inhibit KDR/VEGFR2-dependent angiogenesis; the function involves inhibition Storage of VEGF-induced phosphoprylation of the Akt Maintain refrigerated at 2-8°C for up to 2 signaling pathway.