Olena Fedyuk Marta Kindler Editors Lessons from Migration Studies
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
The Case of Spain and Its Distinctive Demeanor Toward Its Immigrants
University of Mississippi eGrove Honors College (Sally McDonnell Barksdale Honors Theses Honors College) Spring 5-9-2020 Public Sentiment Toward Migration in a Globalizing World: The Case of Spain and its Distinctive Demeanor Toward its Immigrants Caroline Thompson Follow this and additional works at: https://egrove.olemiss.edu/hon_thesis Part of the European History Commons, International Relations Commons, Migration Studies Commons, and the Other Languages, Societies, and Cultures Commons Recommended Citation Thompson, Caroline, "Public Sentiment Toward Migration in a Globalizing World: The Case of Spain and its Distinctive Demeanor Toward its Immigrants" (2020). Honors Theses. 1548. https://egrove.olemiss.edu/hon_thesis/1548 This Undergraduate Thesis is brought to you for free and open access by the Honors College (Sally McDonnell Barksdale Honors College) at eGrove. It has been accepted for inclusion in Honors Theses by an authorized administrator of eGrove. For more information, please contact [email protected]. PUBLIC SENTIMENT TOWARD MIGRATION IN A GLOBALIZING WORLD: THE CASE OF SPAIN AND ITS DISTINCTIVE DEMEANOR TOWARD ITS IMMIGRANTS by Caroline Elizabeth Thompson A thesis submitted by the faculty of The University of Mississippi in partial fulfillment of the requirements for completion of the Bachelor of Arts degree in International Studies at the Croft Institute for International Studies and the Sally McDonnell Barksdale Honors College. University, Mississippi May 2020 Approved by Advisor: Dr. Miguel Centellas Reader: Dr. Gang Guo Reader: Dr. Simone Delerme Abstract This thesis discusses Spain's overall public opinion around immigration, exploring factors that contribute to the development of a country's attitude toward its immigrants. Spain exemplifies a particularly distinctive attitude in relation to its European Mediterranean counterparts, displaying an increased receptiveness toward its immigrant population. -
The Annals of UVAN, Vol . V-VI, 1957, No. 4 (18)
THE ANNALS of the UKRAINIAN ACADEMY of Arts and Sciences in the U. S. V o l . V-VI 1957 No. 4 (18) -1, 2 (19-20) Special Issue A SURVEY OF UKRAINIAN HISTORIOGRAPHY by Dmytro Doroshenko Ukrainian Historiography 1917-1956 by Olexander Ohloblyn Published by THE UKRAINIAN ACADEMY OF ARTS AND SCIENCES IN THE U.S., Inc. New York 1957 EDITORIAL COMMITTEE DMITRY CIZEVSKY Heidelberg University OLEKSANDER GRANOVSKY University of Minnesota ROMAN SMAL STOCKI Marquette University VOLODYMYR P. TIM OSHENKO Stanford University EDITOR MICHAEL VETUKHIV Columbia University The Annals of the Ukrainian Academy of Arts and Sciences in the U. S. are published quarterly by the Ukrainian Academy of Arts and Sciences in the U.S., Inc. A Special issue will take place of 2 issues. All correspondence, orders, and remittances should be sent to The Annals of the Ukrainian Academy of Arts and Sciences in the U. S. ПУ2 W est 26th Street, New York 10, N . Y. PRICE OF THIS ISSUE: $6.00 ANNUAL SUBSCRIPTION PRICE: $6.00 A special rate is offered to libraries and graduate and undergraduate students in the fields of Slavic studies. Copyright 1957, by the Ukrainian Academy of Arts and Sciences in the U.S.} Inc. THE ANNALS OF THE UKRAINIAN ACADEMY OF ARTS AND SCIENCES IN THE U.S., INC. S p e c i a l I s s u e CONTENTS Page P r e f a c e .......................................................................................... 9 A SURVEY OF UKRAINIAN HISTORIOGRAPHY by Dmytro Doroshenko In tr o d u c tio n ...............................................................................13 Ukrainian Chronicles; Chronicles from XI-XIII Centuries 21 “Lithuanian” or West Rus’ C h ro n ic le s................................31 Synodyky or Pom yannyky..........................................................34 National Movement in XVI-XVII Centuries and the Revival of Historical Tradition in Literature ......................... -
Moroccan Women and Immigration in Spanish Narrative and Film (1995-2008)
University of Kentucky UKnowledge University of Kentucky Doctoral Dissertations Graduate School 2010 MOROCCAN WOMEN AND IMMIGRATION IN SPANISH NARRATIVE AND FILM (1995-2008) Sandra Stickle Martín University of Kentucky, [email protected] Right click to open a feedback form in a new tab to let us know how this document benefits ou.y Recommended Citation Martín, Sandra Stickle, "MOROCCAN WOMEN AND IMMIGRATION IN SPANISH NARRATIVE AND FILM (1995-2008)" (2010). University of Kentucky Doctoral Dissertations. 766. https://uknowledge.uky.edu/gradschool_diss/766 This Dissertation is brought to you for free and open access by the Graduate School at UKnowledge. It has been accepted for inclusion in University of Kentucky Doctoral Dissertations by an authorized administrator of UKnowledge. For more information, please contact [email protected]. ABSTRACT OF DISSERTATION Sandra Stickle Martín The Graduate School University of Kentucky 2010 MOROCCAN WOMEN AND IMMIGRATION IN SPANISH NARRATIVE AND FILM (1995-2008) ___________________________________ ABSTRACT OF DISSERTATION ____________________________________ A dissertation submitted in partial fulfillment of the requirements for the degree of doctor of Philosophy in the College of Arts and Sciences at the University of Kentucky By Sandra Stickle Martín Lexington, Kentucky Director: Dr. Ana Rueda, Professor of Hispanic Studies Lexington, Kentucky 2010 Copyright © Sandra Stickle Martín 2010 ABSTRACT OF DISSERTATION MOROCCAN WOMEN AND IMMIGRATION IN SPANISH NARRATIVE AND FILM (1995-2008) Spanish migration narratives and films present a series of conflicting forces: the assumptions of entitlement of both Western and Oriental patriarchal authority, the claims to autonomy and self determination by guardians of women’s rights, the confrontations between advocates of exclusion and hospitality in the host society, and the endeavor of immigrant communities to maintain traditions while they integrate into Spanish society. -
The Ukrainian Weekly 2012, No.39
www.ukrweekly.com INSIDE: l Russia’s “soft power with an iron fist” – page 3 l The Ukrainian minority in Poland, 1944-1947 – page 9 l Tennis championships at Soyuzivka – page 11 THEPublished U by theKRAINIAN Ukrainian National Association Inc., a fraternal W non-profit associationEEKLY Vol. LXXX No. 39 THE UKRAINIAN WEEKLY SUNDAY, SEPTEMBER 23, 2012 $1/$2 in Ukraine Foreign Relations Ukraine’s 2012 parliamentary elections: Committee approves Two parties that might make the cut Tymoshenko resolution by Zenon Zawada Special to The Ukrainian Weekly WASHINGTON – A resolution intro- duced by U.S. Sen. Jim Inhofe (R-Okla.), a KYIV – Polls indicate that at least four member of the Senate Foreign Relations political parties will qualify for the 2012 Committee, and co-sponsored by U.S. Verkhovna Rada. Another two parties have Sen. Dick Durbin (D-Ill.), Senate majori- a chance of surpassing the 5 percent ty whip, on September 19 unanimously threshold on election day, October 28: the passed the Senate Foreign Relations Ukraine – Forward! party launched by Luhansk oligarch Natalia Korolevska and Committee. The resolution, S. Res. 466, the Svoboda nationalist party launched by calls for the unconditional release of Oleh Tiahnybok. political prisoner and former Ukrainian At the moment, however, both parties Prime Minister Yulia Tymoshenko. would fail to qualify. Ukraine – Forward! “Tymoshenko was a key revolution- would earn 4 percent of the votes for ary in Ukraine’s 2004 Orange closed party lists, while Svoboda would get Revolution and is a pro-Western reform- about 3.8 percent, according to a poll er,” said Sen. -
The Ukrainian Weekly 1997, No.46
www.ukrweekly.com INSIDE: • Ukrainian community life in Russia — page 3. • Veterans’ Day/Remembrance Day features, reports on Ukrainian-American • Military Association, Ukrainian American Veterans — pages 8-11. HE KRAINI A N EEKLY T PublishedU by the Ukrainian National Association Inc., a fraternal non-profitW association Vol. LXV No. 46 THE UKRAINIAN WEEKLY SUNDAY, NOVEMBER 16, 1997 $1.25/$2 in Ukraine UNA General Assembly holds October Revolution Day marked by clashes by Roman Woronowycz With more than 80,000 people taking pre-convention annual meeting Kyiv Press Bureau part in various demonstrations and com- memorations throughout Ukraine, some to by Roma Hadzewycz gates (who must ratify any changes by a KYIV — Nationalists and Communists commemorate the Bolshevik October two-thirds majority); clashed in Lviv on November 7 during KERHONKSON, N.Y. — The Revolution and others the slaughter of thou- • adopted a budget for 1998 of demonstrations and rallies on the 80th sands of Ukrainians during the 1930s in Ukrainian National Association’s General $10,774,000 in income and $11,024,000 anniversary of the October Revolution. Assembly met here at the UNA estate, what is called the Fusilladed Renaissance in expenses; Five people were injured and five others Soyuzivka, on November 6-8 for its annual (Rozstriliane Vidrodzhennia), the violence • confirmed the Executive Committee’s have been arrested. meeting — its last before the regular con- in Lviv was relatively minor. However, it acceptance of a request made by Treasurer The violence began when some 300 vention of the largest Ukrainian fraternal caused an outcry from Communists in the Alexander Blahitka for a leave of absence Communists and Socialists veered away Verkhovna Rada, who refused to register benefit society, which is scheduled to take for medical reasons, effective immediately place in May of next year in Toronto. -
Mapping Foreign Nationals in Spain: an Exploratory Approach at Local Level Sébastien Oliveau, Quentin Larue, Yoann Doignon, Isabelle Blöss-Widmer
Mapping foreign nationals in Spain: an exploratory approach at local level Sébastien Oliveau, Quentin Larue, Yoann Doignon, Isabelle Blöss-Widmer To cite this version: Sébastien Oliveau, Quentin Larue, Yoann Doignon, Isabelle Blöss-Widmer. Mapping foreign nationals in Spain: an exploratory approach at local level. Genus: Journal of Population Sciences, Springer/ Sapienza University of Rome, 2019, 75 (1), 10.1186/s41118-018-0047-5. hal-01986600 HAL Id: hal-01986600 https://hal.archives-ouvertes.fr/hal-01986600 Submitted on 18 Jan 2019 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Oliveau et al. Genus (2019) 75:5 https://doi.org/10.1186/s41118-018-0047-5 Genus ORIGINAL ARTICLE Open Access Mapping foreign nationals in Spain: an exploratory approach at local level Sébastien Oliveau2, Quentin Larue2, Yoann Doignon1,2* and Isabelle Blöss-Widmer1 * Correspondence: yoann.doignon@ univ-amu.fr Abstract 1Aix Marseille Univ, CNRS, LAMES, UMR 7305, Aix-en-Provence, France Spain, which has long been a country of emigration, has become, within a few years, 2Aix Marseille Univ, Université Côte one of the European countries which welcomes the most foreign nationals onto its d’Azur, Avignon Université, CNRS, territory. -
Bulge Rules-48
Borodino 1 BORODINO A Triumph & Glory Game By Richard Berg RULE BOOK Table of Contents 1.0 Introduction ................................................ 2 8.0 Artillery Fire ............................................... 8 2.0 Components ................................................ 2 9.0 Shock Combat ............................................ 9 3.0 Sequence of Play ........................................ 3 10.0 Rally and Recovery .................................... 15 4.0 Initiative ...................................................... 3 11.0 Jaegers ........................................................ 15 5.0 Orders and Activation ................................. 4 Scenarios 6.0 Facing, Stacking, & Zones of Control ........ 6 The Battle of Schevardino Redoubt .................... 16 7.0 Movement ................................................... 7 The Battle of Borodino ........................................ 17 © 2003 GMT Games, LLC P.O. Box 1308, Hanford, CA 93232-1308 www.GMTGames.com #0401 © 2004 GMT Games, LLC 2 Triumph & Glory v2.2 Because of the changes in command structure, the counters’ Unit 1.0 Introduction Designations often reflect differing hierarchy and unit type. Each The Triumph & Glory system covers battles of the Napoleonic Wars, scenario briefly describes what the counters for that unit represent. with an emphasis on accessibility and playability, plus as much his- torical flavor as we can slather on. Given a choice between play- The Activation Markers indicate which group of units will get to ability and detail, we have tended to “err” on the side of the former. move next (see Section 5). This game uses version 2.2 of the Triumph & Glory system. It con- The Orders Markers designate which Orders Commands are “Un- tains several significant changes from the original rules, specifi- der Orders” or have “No Orders.” cally in the Cavalry Charge mechanics as well as the replacement of the Rout rules with the new Withdrawal rules. -
Folklore and the Construction of National Identity in Nineteenth Century Russian Literature
Folklore and the Construction of National Identity in Nineteenth Century Russian Literature Jessika Aguilar Submitted in partial fulfillment of the Requirements for the degree of Doctor of Philosophy In the Graduate School of Arts and Sciences Columbia University 2016 © 2016 Jessika Aguilar All rights reserved Table of Contents 1. Introduction……………………………………………………………………………..…..1 2. Alexander Pushkin: Folklore without the Folk……………………………….20 3. Nikolai Gogol: Folklore and the Fragmentation of Authorship……….54 4. Vladimir Dahl: The Folk Speak………………………………………………..........84 5. Conclusion……………………………………………………………………………........116 6. Bibliography………………………………………………………………………………122 i Introduction In his “Literary Reveries” of 1834 Vissarion Belinsky proclaimed, “we have no literature” (Belinskii PSS I:22). Belinsky was in good company with his assessment. Such sentiments are rife in the critical essays and articles of the first third of the nineteenth century. A decade earlier, Aleksandr Bestuzhev had declared that, “we have a criticism but no literature” (Leighton, Romantic Criticism 67). Several years before that, Pyotr Vyazemsky voiced a similar opinion in his article on Pushkin’s Captive of the Caucasus : “A Russian language exists, but a literature, the worthy expression of a mighty and virile people, does not yet exist!” (Leighton, Romantic Criticism 48). These histrionic claims are evidence of Russian intellectuals’ growing apprehension that there was nothing Russian about the literature produced in Russia. There was a prevailing belief that -
Migration and the Ukraine Crisis a Two-Country Perspective This E-Book Is Provided Without Charge Via Free Download by E-International Relations (
EDITED BY AGNIESZKA PIKULICKA-WILCZEWSKA & GRETA UEHLING Migration and the Ukraine Crisis A Two-Country Perspective This e-book is provided without charge via free download by E-International Relations (www.E-IR.info). It is not permitted to be sold in electronic format under any circumstances. If you enjoy our free e-books, please consider leaving a small donation to allow us to continue investing in open access publications: http://www.e-ir.info/about/donate/ i Migration and the Ukraine Crisis A Two-Country Perspective EDITED BY AGNIESZKA PIKULICKA-WILCZEWSKA & GRETA UEHLING ii E-International Relations www.E-IR.info Bristol, England 2017 ISBN 978-1-910814-27-7 (paperback) ISBN 978-1-910814-28-4 (e-book) This book is published under a Creative Commons CC BY-NC 4.0 license. You are free to: • Share – copy and redistribute the material in any medium or format • Adapt – remix, transform, and build upon the material Under the following terms: • Attribution – You must give appropriate credit, provide a link to the license, and indicate if changes were made. You may do so in any reasonable manner, but not in any way that suggests the licensor endorses you or your use. • Non-Commercial – You may not use the material for commercial purposes. Any of the above conditions can be waived if you get permission. Please contact [email protected] for any such enquiries, including for licensing and translation requests. Other than the terms noted above, there are no restrictions placed on the use and dissemination of this book for student learning materials / scholarly use. -
Journal of Eurasian Studies
JOURNAL OF EURASIAN STUDIES _____________________________________________________________________________________ Journal of the Gábor Bálint de Szentkatolna Society Founded: 2009. Internet: www.federatio.org/joes.html _____________________________________________________________________________________ Volume II., Issue 1. / January — March 2010 ____________________ ISSN 1877‐4199 January‐March 2010 JOURNAL OF EURASIAN STUDIES Volume II., Issue 1. _____________________________________________________________________________________ Publisher Foundation ʹStichting MIKES INTERNATIONALʹ, established in The Hague, Holland. Account: Postbank rek.nr. 7528240 Registered: Stichtingenregister: S 41158447 Kamer van Koophandel en Fabrieken Den Haag Distribution The periodical can be downloaded from the following Internet‐address: http://www.federatio.org/joes.html If you wish to subscribe to the email mailing list, you can do it by sending an email to the following address: mikes_int‐[email protected] The publisher has no financial sources. It is supported by many in the form of voluntary work and gifts. We kindly appreciate your gifts. Address The Editors and the Publisher can be contacted at the following addresses: Email: [email protected] Postal address: P.O. Box 10249, 2501 HE, Den Haag, Holland Individual authors are responsible for facts included and views expressed in their articles. _____________________________________ ISSN 1877‐4199 © Mikes International, 2001‐2010, All Rights Reserved _____________________________________________________________________________________ -
Ioana Popescu Shanghai,China Bucharest, Romania
0\/LIH6WRU\ ,RDQD3RSHVFX .D\/RZGHU6WRU\NHHSHU $FNQRZOHGJHPHQWV 7KH (WKQLF /LIH 6WRULHV 3URMHFW FRQWLQXHV WR HPXODWH WKH YLEUDQW GLYHUVLW\ RI WKH 6SULQJILHOGFRPPXQLW\6RPXFKLVRZHGWRWKHPDQ\LQGLYLGXDOVIURP'UXU\ 8QLYHUVLW\'LYHUVLW\ &HQWHU 6RXWKZHVW 0LVVRXUL 6WDWH 8QLYHUVLW\ )RUHVW ,QVWLWXWH 6SULQJILHOG3XEOLF6FKRRO6\VWHP6SULQJILHOG*UHHQH&RXQW\/LEUDULHVDQG6RXWKZHVW 0LVVRXUL 2IILFH RQ $JLQJ ZKR EHVWRZHG WKHLU WDOHQWV WKHLU ZRUGV RI HQFRXUDJHPHQW WKHLUJHQHURVLW\RIWLPHDQGFRQWULEXWLRQVLQVXSSRUWRIWKLVXQLTXHRSSRUWXQLW\WRHQULFK RXUFRPPXQLW\ 7KHUHVROYHDQGFRPPLWPHQWRIERWKWKH6WRU\7HOOHUVDQG6WRU\.HHSHUVIDVKLRQHGWKH LQWHJUDO IRXQGDWLRQ RI WKLV FUHDWLYH DFFRPSOLVKPHQW :H H[SUHVV RXU WUHPHQGRXV DGPLUDWLRQ WR WKH 6WRU\ 7HOOHUV ZKR VKDUHG WKHLU SULYDWH DQG LQQHUPRVW WKRXJKWV DQG PHPRULHVVRPHVXIIHULQJH[WUHPHKDUGVKLSDQGFKDRVGLVDSSRLQWPHQWDQGJULHIEHIRUH DUULYLQJ KHUH DQGDFKLHYLQJWKHJUHDWWDVNRIDGMXVWLQJDQGDVVLPLODWLQJLQWRDGLIIHUHQW FXOWXUH :H UHFRJQL]H \RXU ZRUN DQG GLOLJHQFH LQ \RXU OLIH DFKLHYHPHQW QRW RQO\ E\ NHHSLQJ \RXU IDPLOLHV WRJHWKHU EXW E\ VKDULQJ FRQWULEXWLQJ DQG DW WKH VDPH WLPH HQULFKLQJRXUOLYHVDQGFRPPXQLW\:HVDOXWH\RX 6SHFLDODFNQRZOHGJHPHQWWR 5RVDOLQD+ROOLQJHU(GLWLQJDQGOD\RXWGHVLJQ 0DUN+ROOLQJHU 3KRWRJUDSK\ -LP&RRPE0DSPDNHU ,GHOO/HZLV(GLWLQJDQGUHYLVLRQ $QJLH.HOOHU6XV\0RVWURP7HUHVD9DQ6O\NHDQG6HDQ.LPEHOO7UDQVODWLRQ /HH/RZGHU'DWD7UDQVIHUDQG6WRUDJH +HDUWIHOWWKDQNVWR.D\/RZGHUZKRZDVUHVSRQVLEOHIRURUJDQL]DWLRQDQGDVVHPEO\RI WKHVWRULHV -LP0DXOGLQ (WKQLF/LIH6WRULHV3URMHFW&RRUGLQDWRU The Ethnic Life Stories Project.... .giving the Springfield community a window -
The Crimean Tatar Question: a Prism for Changing Nationalisms and Rival Versions of Eurasianism*
The Crimean Tatar Question: A Prism for Changing Nationalisms and Rival Versions of Eurasianism* Andrew Wilson Abstract: This article discusses the ongoing debates about Crimean Tatar identity, and the ways in which the Crimean Tatar question has been crucial to processes of reshaping Ukrainian identity during and after the Euromaidan. The Crimean Tatar question, it is argued, is a key test in the struggle between civic and ethnic nationalism in the new Ukraine. The article also looks at the manner in which the proponents of different versions of “Eurasianism”—Russian, Volga Tatar, and Crimean Tatar—have approached the Crimean Tatar question, and how this affects the attitudes of all these ethnic groups to the Russian annexation of Crimea. Key words: Crimean Tatars, Euromaidan, Eurasianism, national identity, nationalism—civic and ethnic Introduction In the period either side of the Russian annexation of Crimea, the Crimean Tatar issue has become a lodestone for redefining the national identities of all the parties involved. The mainstream Crimean Tatar movement has been characterized by steadfast opposition first to the Yanukovych regime in Ukraine and then to Russian rule. This position has strengthened its longstanding ideology of indigenousness and special rights, but it has also * The author is extremely grateful to Ridvan Bari Urcosta for his invaluable help with research for this article, to Bob Deen and Zahid Movlazada at the OSCE HCNM, to Professor Paul Robert Magocsi, and to the anonymous reviewers who made useful comments and criticisms. 1 2 ANDREW WILSON belatedly cemented its alliance with Ukrainian nationalism. Meanwhile, Ukraine’s would‐be new supra‐ethnic civic identity draws heavily on the Crimean Tatar contribution.