DOCSLIB.ORG

Olena Fedyuk Marta Kindler Editors Lessons from Migration Studies

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Olena Fedyuk Marta Kindler Editors Lessons from Migration Studies IMISCOE Research Series Olena Fedyuk Marta Kindler Editors Ukrainian Migration to the European Union Lessons from Migration Studies IMISCOE Research Series This series is the official book series of IMISCOE, the largest network of excellence on migration and diversity in the world. It comprises publications which present empirical and theoretical research on different aspects of international migration. The authors are all specialists, and the publications a rich source of information for researchers and others involved in international migration studies. The series is published under the editorial supervision of the IMISCOE Editorial Committee which includes leading scholars from all over Europe. The series, which contains more than eighty titles already, is internationally peer reviewed which ensures that the book published in this series continue to present excellent academic standards and scholarly quality. Most of the books are available open access. For information on how to submit a book proposal, please visit: http://www. imiscoe.org/publications/how-to-submit-a-book-proposal. More information about this series at http://www.springer.com/series/13502 Olena Fedyuk • Marta Kindler Editors Ukrainian Migration to the European Union Lessons from Migration Studies Editors Olena Fedyuk Marta Kindler Marie Curie Changing Employment ITN Centre of Migration Research University of Strathclyde University of Warsaw Glasgow, UK Warsaw, Poland ISSN 2364-4087 ISSN 2364-4095 (electronic) IMISCOE Research Series ISBN 978-3-319-41774-5 ISBN 978-3-319-41776-9 (eBook) DOI 10.1007/978-3-319-41776-9 Library of Congress Control Number: 2016953852 © The Editor(s) (if applicable) and The Author(s) 2016. This book is published open access. Open Access This book is distributed under the terms of the Creative Commons Attribution- Noncommercial 2.5 License (http://creativecommons.org/licenses/by-nc/2.5/) which permits any non- commercial use, distribution, and reproduction in any medium, provided the original author(s) and source are credited. The images or other third party material in this book are included in the work’s Creative Commons license, unless indicated otherwise in the credit line; if such material is not included in the work’s Creative Commons license and the respective action is not permitted by statutory regulation, users will need to obtain permission from the license holder to duplicate, adapt or reproduce the material. This work is subject to copyright. All commercial rights are reserved by the Publisher, whether the whole or part of the material is concerned, specifically the rights of translation, reprinting, reuse of illustrations, recitation, broadcasting, reproduction on microfilms or in any other physical way, and transmission or information storage and retrieval, electronic adaptation, computer software, or by similar or dissimilar methodology now known or hereafter developed. The use of general descriptive names, registered names, trademarks, service marks, etc. in this publication does not imply, even in the absence of a specific statement, that such names are exempt from the relevant protective laws and regulations and therefore free for general use. The publisher, the authors and the editors are safe to assume that the advice and information in this book are believed to be true and accurate at the date of publication. Neither the publisher nor the authors or the editors give a warranty, express or implied, with respect to the material contained herein or for any errors or omissions that may have been made. Printed on acid-free paper This Springer imprint is published by Springer Nature The registered company is Springer International Publishing AG Switzerland The original version of this book was revised. An erratum to this book can be found at DOI 10.1007/978-3-319-41776-9_14 Foreword and Acknowledgements This book is the result of a collective activity. Beneath the visible road signs of edi- tors, authors and titles, there lies a collective history of scholarship and collabora- tion. This book is the outcome of five years of cooperation by international scholars and experts under the aegis of the International Migration, Integration and Social Cohesion in Europe (IMISCOE) research cluster “Ukrainian migration to the European Union”. Several workshops preceded the publication of this book, start- ing with one on the current state of research on Ukrainian migration to the EU which took place during the 2011 IMISCOE annual conference. Our interest in Ukrainian migration has different roots, but there are some com- mon traits as well, particularly curiosity about mobility within Europe beyond the EU border zone. Additionally, both editors have experienced migration to the EU and overseas and have written doctoral theses, one at the Central European University and the other at the European University Viadrina, about Ukrainian women migrating to the domestic work sectors in Italy and in Poland. As the editors of the book, we would like to thank the institutions that have sup- ported its publication financially: the IMISCOE Research Network, the Centre of Migration Research at the University of Warsaw and the Marie Curie Changing Employment Initial Training Network. We thank all the contributors of this book for their patience and diligence during multiple rounds of revisions. For thoughtful comments on drafts of chapters, we are grateful to colleagues from the Centre of Migration Research. We are also thankful to the anonymous referees who have evaluated this manuscript. Finally, our thanks go to Keith Povey who has done an incredible language-editing job on the manuscript. Warsaw, Poland Marta Kindler Glasgow, UK Olena Fedyuk vii Contents 1 Migration of Ukrainians to the European Union: Background and Key Issues.................................................................... 1 Olena Fedyuk and Marta Kindler Part I Continuities and Changes in Ukrainian Migration: An Analytical Review of Literature 2 Ukrainian Migration Research Before and Since 1991........................ 17 Bastian Vollmer and Olena Malynovska 3 Economic Aspects of Ukrainian Migration to EU Countries............... 35 Olga Kupets 4 Regulating Movement of the Very Mobile: Selected Legal and Policy Aspects of Ukrainian Migration to EU Countries.............. 51 Monika Szulecka 5 The Gender Perspective in Ukrainian Migration................................. 73 Olena Fedyuk 6 The Temporary Nature of Ukrainian Migration: Definitions, Determinants and Consequences............................................................ 91 Agata Górny and Marta Kindler Part II Ukrainian Migration to Selected EU Countries: Facts, Figures and the State of Literature 7 Ukrainian Migration to Poland: A “Local” Mobility?......................... 115 Zuzanna Brunarska, Marta Kindler, Monika Szulecka, and Sabina Toruńczyk-Ruiz ix x Contents 8 Ukrainians in the Czech Republic: On the Pathway from Temporary Foreign Workers to One of the Largest Minority Groups...................................................................................... 133 Yana Leontiyeva 9 Ukrainian Migration to Greece: from Irregular Work to Settlement, Family Reunification and Return........................ 151 Marina Nikolova and Michaela Maroufof 10 Migration of Ukrainian Nationals to Italy: Women on the Move.............................................................................................. 163 Francesca Alice Vianello 11 Migration of Ukrainian Nationals to Portugal: The Visibility of a New Migration Landscape....................................... 179 Maria Lucinda Fonseca and Sónia Pereira 12 Research on Ukrainian Migration to Spain: Moving Beyond the Exploratory Approach....................................................................... 193 Mikołaj Stanek, Renáta Hosnedlová, and Elisa Brey 13 Theorizing the Ukrainian Case: Pushing the Boundaries of Migration Studies Through a Europe–US Comparison................... 215 Cinzia D. Solari Erratum............................................................................................................ E1 Index.................................................................................................................. 229 Chapter 1 Migration of Ukrainians to the European Union: Background and Key Issues Olena Fedyuk and Marta Kindler 1.1 Introduction Ukrainians form one of the largest groups of all third-country nationals living and working in the European Union (EU), yet in the contemporary research environ- ment, their migration to the EU goes unnoticed, and Ukrainians are seen mainly as one of the “migrant groups” in studies concerning Central and Eastern European migrants. Why has this subject been studied so little? Or has it been studied, but without stirring wider public or political interest? This volume brings together a team of scholars from a range of disciplines to trace the dynamics of Ukrainian migration and its research over the last three decades and to provide a comprehen- sive overview of the available literature on Ukrainian migration to the EU. Ukrainian migration to the EU is interesting for contemporary migration studies for four reasons. First, it is the largest of all post-USSR migratory movements to the EU and thus a trend-setter for migrants from the post-Soviet space, who use their experience of the Soviet past as a form of social capital in migration. Second, with over 300,000 first residence permits issued to nationals of Ukraine in 2014,1 they provide a valuable case for comparative studies
Load more

Recommended publications
  • The Case of Spain and Its Distinctive Demeanor Toward Its Immigrants
    University of Mississippi eGrove Honors College (Sally McDonnell Barksdale Honors Theses Honors College) Spring 5-9-2020 Public Sentiment Toward Migration in a Globalizing World: The Case of Spain and its Distinctive Demeanor Toward its Immigrants Caroline Thompson Follow this and additional works at: https://egrove.olemiss.edu/hon_thesis Part of the European History Commons, International Relations Commons, Migration Studies Commons, and the Other Languages, Societies, and Cultures Commons Recommended Citation Thompson, Caroline, "Public Sentiment Toward Migration in a Globalizing World: The Case of Spain and its Distinctive Demeanor Toward its Immigrants" (2020). Honors Theses. 1548. https://egrove.olemiss.edu/hon_thesis/1548 This Undergraduate Thesis is brought to you for free and open access by the Honors College (Sally McDonnell Barksdale Honors College) at eGrove. It has been accepted for inclusion in Honors Theses by an authorized administrator of eGrove. For more information, please contact [email protected]. PUBLIC SENTIMENT TOWARD MIGRATION IN A GLOBALIZING WORLD: THE CASE OF SPAIN AND ITS DISTINCTIVE DEMEANOR TOWARD ITS IMMIGRANTS by Caroline Elizabeth Thompson A thesis submitted by the faculty of The University of Mississippi in partial fulfillment of the requirements for completion of the Bachelor of Arts degree in International Studies at the Croft Institute for International Studies and the Sally McDonnell Barksdale Honors College. University, Mississippi May 2020 Approved by Advisor: Dr. Miguel Centellas Reader: Dr. Gang Guo Reader: Dr. Simone Delerme Abstract This thesis discusses Spain's overall public opinion around immigration, exploring factors that contribute to the development of a country's attitude toward its immigrants. Spain exemplifies a particularly distinctive attitude in relation to its European Mediterranean counterparts, displaying an increased receptiveness toward its immigrant population.
    [Show full text]
  • The Annals of UVAN, Vol . V-VI, 1957, No. 4 (18)
    THE ANNALS of the UKRAINIAN ACADEMY of Arts and Sciences in the U. S. V o l . V-VI 1957 No. 4 (18) -1, 2 (19-20) Special Issue A SURVEY OF UKRAINIAN HISTORIOGRAPHY by Dmytro Doroshenko Ukrainian Historiography 1917-1956 by Olexander Ohloblyn Published by THE UKRAINIAN ACADEMY OF ARTS AND SCIENCES IN THE U.S., Inc. New York 1957 EDITORIAL COMMITTEE DMITRY CIZEVSKY Heidelberg University OLEKSANDER GRANOVSKY University of Minnesota ROMAN SMAL STOCKI Marquette University VOLODYMYR P. TIM OSHENKO Stanford University EDITOR MICHAEL VETUKHIV Columbia University The Annals of the Ukrainian Academy of Arts and Sciences in the U. S. are published quarterly by the Ukrainian Academy of Arts and Sciences in the U.S., Inc. A Special issue will take place of 2 issues. All correspondence, orders, and remittances should be sent to The Annals of the Ukrainian Academy of Arts and Sciences in the U. S. ПУ2 W est 26th Street, New York 10, N . Y. PRICE OF THIS ISSUE: $6.00 ANNUAL SUBSCRIPTION PRICE: $6.00 A special rate is offered to libraries and graduate and undergraduate students in the fields of Slavic studies. Copyright 1957, by the Ukrainian Academy of Arts and Sciences in the U.S.} Inc. THE ANNALS OF THE UKRAINIAN ACADEMY OF ARTS AND SCIENCES IN THE U.S., INC. S p e c i a l I s s u e CONTENTS Page P r e f a c e .......................................................................................... 9 A SURVEY OF UKRAINIAN HISTORIOGRAPHY by Dmytro Doroshenko In tr o d u c tio n ...............................................................................13 Ukrainian Chronicles; Chronicles from XI-XIII Centuries 21 “Lithuanian” or West Rus’ C h ro n ic le s................................31 Synodyky or Pom yannyky..........................................................34 National Movement in XVI-XVII Centuries and the Revival of Historical Tradition in Literature .........................
    [Show full text]
  • Moroccan Women and Immigration in Spanish Narrative and Film (1995-2008)
    University of Kentucky UKnowledge University of Kentucky Doctoral Dissertations Graduate School 2010 MOROCCAN WOMEN AND IMMIGRATION IN SPANISH NARRATIVE AND FILM (1995-2008) Sandra Stickle Martín University of Kentucky, [email protected] Right click to open a feedback form in a new tab to let us know how this document benefits ou.y Recommended Citation Martín, Sandra Stickle, "MOROCCAN WOMEN AND IMMIGRATION IN SPANISH NARRATIVE AND FILM (1995-2008)" (2010). University of Kentucky Doctoral Dissertations. 766. https://uknowledge.uky.edu/gradschool_diss/766 This Dissertation is brought to you for free and open access by the Graduate School at UKnowledge. It has been accepted for inclusion in University of Kentucky Doctoral Dissertations by an authorized administrator of UKnowledge. For more information, please contact [email protected]. ABSTRACT OF DISSERTATION Sandra Stickle Martín The Graduate School University of Kentucky 2010 MOROCCAN WOMEN AND IMMIGRATION IN SPANISH NARRATIVE AND FILM (1995-2008) ___________________________________ ABSTRACT OF DISSERTATION ____________________________________ A dissertation submitted in partial fulfillment of the requirements for the degree of doctor of Philosophy in the College of Arts and Sciences at the University of Kentucky By Sandra Stickle Martín Lexington, Kentucky Director: Dr. Ana Rueda, Professor of Hispanic Studies Lexington, Kentucky 2010 Copyright © Sandra Stickle Martín 2010 ABSTRACT OF DISSERTATION MOROCCAN WOMEN AND IMMIGRATION IN SPANISH NARRATIVE AND FILM (1995-2008) Spanish migration narratives and films present a series of conflicting forces: the assumptions of entitlement of both Western and Oriental patriarchal authority, the claims to autonomy and self determination by guardians of women’s rights, the confrontations between advocates of exclusion and hospitality in the host society, and the endeavor of immigrant communities to maintain traditions while they integrate into Spanish society.
    [Show full text]
  • The Ukrainian Weekly 2012, No.39
    www.ukrweekly.com INSIDE: l Russia’s “soft power with an iron fist” – page 3 l The Ukrainian minority in Poland, 1944-1947 – page 9 l Tennis championships at Soyuzivka – page 11 THEPublished U by theKRAINIAN Ukrainian National Association Inc., a fraternal W non-profit associationEEKLY Vol. LXXX No. 39 THE UKRAINIAN WEEKLY SUNDAY, SEPTEMBER 23, 2012 $1/$2 in Ukraine Foreign Relations Ukraine’s 2012 parliamentary elections: Committee approves Two parties that might make the cut Tymoshenko resolution by Zenon Zawada Special to The Ukrainian Weekly WASHINGTON – A resolution intro- duced by U.S. Sen. Jim Inhofe (R-Okla.), a KYIV – Polls indicate that at least four member of the Senate Foreign Relations political parties will qualify for the 2012 Committee, and co-sponsored by U.S. Verkhovna Rada. Another two parties have Sen. Dick Durbin (D-Ill.), Senate majori- a chance of surpassing the 5 percent ty whip, on September 19 unanimously threshold on election day, October 28: the passed the Senate Foreign Relations Ukraine – Forward! party launched by Luhansk oligarch Natalia Korolevska and Committee. The resolution, S. Res. 466, the Svoboda nationalist party launched by calls for the unconditional release of Oleh Tiahnybok. political prisoner and former Ukrainian At the moment, however, both parties Prime Minister Yulia Tymoshenko. would fail to qualify. Ukraine – Forward! “Tymoshenko was a key revolution- would earn 4 percent of the votes for ary in Ukraine’s 2004 Orange closed party lists, while Svoboda would get Revolution and is a pro-Western reform- about 3.8 percent, according to a poll er,” said Sen.
    [Show full text]
  • The Ukrainian Weekly 1997, No.46
    www.ukrweekly.com INSIDE: • Ukrainian community life in Russia — page 3. • Veterans’ Day/Remembrance Day features, reports on Ukrainian-American • Military Association, Ukrainian American Veterans — pages 8-11. HE KRAINI A N EEKLY T PublishedU by the Ukrainian National Association Inc., a fraternal non-profitW association Vol. LXV No. 46 THE UKRAINIAN WEEKLY SUNDAY, NOVEMBER 16, 1997 $1.25/$2 in Ukraine UNA General Assembly holds October Revolution Day marked by clashes by Roman Woronowycz With more than 80,000 people taking pre-convention annual meeting Kyiv Press Bureau part in various demonstrations and com- memorations throughout Ukraine, some to by Roma Hadzewycz gates (who must ratify any changes by a KYIV — Nationalists and Communists commemorate the Bolshevik October two-thirds majority); clashed in Lviv on November 7 during KERHONKSON, N.Y. — The Revolution and others the slaughter of thou- • adopted a budget for 1998 of demonstrations and rallies on the 80th sands of Ukrainians during the 1930s in Ukrainian National Association’s General $10,774,000 in income and $11,024,000 anniversary of the October Revolution. Assembly met here at the UNA estate, what is called the Fusilladed Renaissance in expenses; Five people were injured and five others Soyuzivka, on November 6-8 for its annual (Rozstriliane Vidrodzhennia), the violence • confirmed the Executive Committee’s have been arrested. meeting — its last before the regular con- in Lviv was relatively minor. However, it acceptance of a request made by Treasurer The violence began when some 300 vention of the largest Ukrainian fraternal caused an outcry from Communists in the Alexander Blahitka for a leave of absence Communists and Socialists veered away Verkhovna Rada, who refused to register benefit society, which is scheduled to take for medical reasons, effective immediately place in May of next year in Toronto.
    [Show full text]
  • Mapping Foreign Nationals in Spain: an Exploratory Approach at Local Level Sébastien Oliveau, Quentin Larue, Yoann Doignon, Isabelle Blöss-Widmer
    Mapping foreign nationals in Spain: an exploratory approach at local level Sébastien Oliveau, Quentin Larue, Yoann Doignon, Isabelle Blöss-Widmer To cite this version: Sébastien Oliveau, Quentin Larue, Yoann Doignon, Isabelle Blöss-Widmer. Mapping foreign nationals in Spain: an exploratory approach at local level. Genus: Journal of Population Sciences, Springer/ Sapienza University of Rome, 2019, 75 (1), 10.1186/s41118-018-0047-5. hal-01986600 HAL Id: hal-01986600 https://hal.archives-ouvertes.fr/hal-01986600 Submitted on 18 Jan 2019 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Oliveau et al. Genus (2019) 75:5 https://doi.org/10.1186/s41118-018-0047-5 Genus ORIGINAL ARTICLE Open Access Mapping foreign nationals in Spain: an exploratory approach at local level Sébastien Oliveau2, Quentin Larue2, Yoann Doignon1,2* and Isabelle Blöss-Widmer1 * Correspondence: yoann.doignon@ univ-amu.fr Abstract 1Aix Marseille Univ, CNRS, LAMES, UMR 7305, Aix-en-Provence, France Spain, which has long been a country of emigration, has become, within a few years, 2Aix Marseille Univ, Université Côte one of the European countries which welcomes the most foreign nationals onto its d’Azur, Avignon Université, CNRS, territory.
    [Show full text]
  • Bulge Rules-48
    Borodino 1 BORODINO A Triumph & Glory Game By Richard Berg RULE BOOK Table of Contents 1.0 Introduction ................................................ 2 8.0 Artillery Fire ............................................... 8 2.0 Components ................................................ 2 9.0 Shock Combat ............................................ 9 3.0 Sequence of Play ........................................ 3 10.0 Rally and Recovery .................................... 15 4.0 Initiative ...................................................... 3 11.0 Jaegers ........................................................ 15 5.0 Orders and Activation ................................. 4 Scenarios 6.0 Facing, Stacking, & Zones of Control ........ 6 The Battle of Schevardino Redoubt .................... 16 7.0 Movement ................................................... 7 The Battle of Borodino ........................................ 17 © 2003 GMT Games, LLC P.O. Box 1308, Hanford, CA 93232-1308 www.GMTGames.com #0401 © 2004 GMT Games, LLC 2 Triumph & Glory v2.2 Because of the changes in command structure, the counters’ Unit 1.0 Introduction Designations often reflect differing hierarchy and unit type. Each The Triumph & Glory system covers battles of the Napoleonic Wars, scenario briefly describes what the counters for that unit represent. with an emphasis on accessibility and playability, plus as much his- torical flavor as we can slather on. Given a choice between play- The Activation Markers indicate which group of units will get to ability and detail, we have tended to “err” on the side of the former. move next (see Section 5). This game uses version 2.2 of the Triumph & Glory system. It con- The Orders Markers designate which Orders Commands are “Un- tains several significant changes from the original rules, specifi- der Orders” or have “No Orders.” cally in the Cavalry Charge mechanics as well as the replacement of the Rout rules with the new Withdrawal rules.
    [Show full text]
  • Folklore and the Construction of National Identity in Nineteenth Century Russian Literature
    Folklore and the Construction of National Identity in Nineteenth Century Russian Literature Jessika Aguilar Submitted in partial fulfillment of the Requirements for the degree of Doctor of Philosophy In the Graduate School of Arts and Sciences Columbia University 2016 © 2016 Jessika Aguilar All rights reserved Table of Contents 1. Introduction……………………………………………………………………………..…..1 2. Alexander Pushkin: Folklore without the Folk……………………………….20 3. Nikolai Gogol: Folklore and the Fragmentation of Authorship……….54 4. Vladimir Dahl: The Folk Speak………………………………………………..........84 5. Conclusion……………………………………………………………………………........116 6. Bibliography………………………………………………………………………………122 i Introduction In his “Literary Reveries” of 1834 Vissarion Belinsky proclaimed, “we have no literature” (Belinskii PSS I:22). Belinsky was in good company with his assessment. Such sentiments are rife in the critical essays and articles of the first third of the nineteenth century. A decade earlier, Aleksandr Bestuzhev had declared that, “we have a criticism but no literature” (Leighton, Romantic Criticism 67). Several years before that, Pyotr Vyazemsky voiced a similar opinion in his article on Pushkin’s Captive of the Caucasus : “A Russian language exists, but a literature, the worthy expression of a mighty and virile people, does not yet exist!” (Leighton, Romantic Criticism 48). These histrionic claims are evidence of Russian intellectuals’ growing apprehension that there was nothing Russian about the literature produced in Russia. There was a prevailing belief that
    [Show full text]
  • Migration and the Ukraine Crisis a Two-Country Perspective This E-Book Is Provided Without Charge Via Free Download by E-International Relations (
    EDITED BY AGNIESZKA PIKULICKA-WILCZEWSKA & GRETA UEHLING Migration and the Ukraine Crisis A Two-Country Perspective This e-book is provided without charge via free download by E-International Relations (www.E-IR.info). It is not permitted to be sold in electronic format under any circumstances. If you enjoy our free e-books, please consider leaving a small donation to allow us to continue investing in open access publications: http://www.e-ir.info/about/donate/ i Migration and the Ukraine Crisis A Two-Country Perspective EDITED BY AGNIESZKA PIKULICKA-WILCZEWSKA & GRETA UEHLING ii E-International Relations www.E-IR.info Bristol, England 2017 ISBN 978-1-910814-27-7 (paperback) ISBN 978-1-910814-28-4 (e-book) This book is published under a Creative Commons CC BY-NC 4.0 license. You are free to: • Share – copy and redistribute the material in any medium or format • Adapt – remix, transform, and build upon the material Under the following terms: • Attribution – You must give appropriate credit, provide a link to the license, and indicate if changes were made. You may do so in any reasonable manner, but not in any way that suggests the licensor endorses you or your use. • Non-Commercial – You may not use the material for commercial purposes. Any of the above conditions can be waived if you get permission. Please contact [email protected] for any such enquiries, including for licensing and translation requests. Other than the terms noted above, there are no restrictions placed on the use and dissemination of this book for student learning materials / scholarly use.
    [Show full text]
  • Journal of Eurasian Studies
    JOURNAL OF EURASIAN STUDIES _____________________________________________________________________________________ Journal of the Gábor Bálint de Szentkatolna Society Founded: 2009. Internet: www.federatio.org/joes.html _____________________________________________________________________________________ Volume II., Issue 1. / January — March 2010 ____________________ ISSN 1877‐4199 January‐March 2010 JOURNAL OF EURASIAN STUDIES Volume II., Issue 1. _____________________________________________________________________________________ Publisher Foundation ʹStichting MIKES INTERNATIONALʹ, established in The Hague, Holland. Account: Postbank rek.nr. 7528240 Registered: Stichtingenregister: S 41158447 Kamer van Koophandel en Fabrieken Den Haag Distribution The periodical can be downloaded from the following Internet‐address: http://www.federatio.org/joes.html If you wish to subscribe to the email mailing list, you can do it by sending an email to the following address: mikes_int‐[email protected] The publisher has no financial sources. It is supported by many in the form of voluntary work and gifts. We kindly appreciate your gifts. Address The Editors and the Publisher can be contacted at the following addresses: Email: [email protected] Postal address: P.O. Box 10249, 2501 HE, Den Haag, Holland Individual authors are responsible for facts included and views expressed in their articles. _____________________________________ ISSN 1877‐4199 © Mikes International, 2001‐2010, All Rights Reserved _____________________________________________________________________________________
    [Show full text]
  • Ioana Popescu Shanghai,China Bucharest, Romania
    0\/LIH6WRU\ ,RDQD3RSHVFX .D\/RZGHU6WRU\NHHSHU $FNQRZOHGJHPHQWV 7KH (WKQLF /LIH 6WRULHV 3URMHFW FRQWLQXHV WR HPXODWH WKH YLEUDQW GLYHUVLW\ RI WKH 6SULQJILHOGFRPPXQLW\6RPXFKLVRZHGWRWKHPDQ\LQGLYLGXDOVIURP'UXU\ 8QLYHUVLW\'LYHUVLW\ &HQWHU 6RXWKZHVW 0LVVRXUL 6WDWH 8QLYHUVLW\ )RUHVW ,QVWLWXWH 6SULQJILHOG3XEOLF6FKRRO6\VWHP6SULQJILHOG*UHHQH&RXQW\/LEUDULHVDQG6RXWKZHVW 0LVVRXUL 2IILFH RQ $JLQJ ZKR EHVWRZHG WKHLU WDOHQWV WKHLU ZRUGV RI HQFRXUDJHPHQW WKHLUJHQHURVLW\RIWLPHDQGFRQWULEXWLRQVLQVXSSRUWRIWKLVXQLTXHRSSRUWXQLW\WRHQULFK RXUFRPPXQLW\ 7KHUHVROYHDQGFRPPLWPHQWRIERWKWKH6WRU\7HOOHUVDQG6WRU\.HHSHUVIDVKLRQHGWKH LQWHJUDO IRXQGDWLRQ RI WKLV FUHDWLYH DFFRPSOLVKPHQW :H H[SUHVV RXU WUHPHQGRXV DGPLUDWLRQ WR WKH 6WRU\ 7HOOHUV ZKR VKDUHG WKHLU SULYDWH DQG LQQHUPRVW WKRXJKWV DQG PHPRULHVVRPHVXIIHULQJH[WUHPHKDUGVKLSDQGFKDRVGLVDSSRLQWPHQWDQGJULHIEHIRUH DUULYLQJ KHUH DQGDFKLHYLQJWKHJUHDWWDVNRIDGMXVWLQJDQGDVVLPLODWLQJLQWRDGLIIHUHQW FXOWXUH :H UHFRJQL]H \RXU ZRUN DQG GLOLJHQFH LQ \RXU OLIH DFKLHYHPHQW QRW RQO\ E\ NHHSLQJ \RXU IDPLOLHV WRJHWKHU EXW E\ VKDULQJ FRQWULEXWLQJ DQG DW WKH VDPH WLPH HQULFKLQJRXUOLYHVDQGFRPPXQLW\:HVDOXWH\RX 6SHFLDODFNQRZOHGJHPHQWWR 5RVDOLQD+ROOLQJHU(GLWLQJDQGOD\RXWGHVLJQ 0DUN+ROOLQJHU 3KRWRJUDSK\ -LP&RRPE0DSPDNHU ,GHOO/HZLV(GLWLQJDQGUHYLVLRQ $QJLH.HOOHU6XV\0RVWURP7HUHVD9DQ6O\NHDQG6HDQ.LPEHOO7UDQVODWLRQ /HH/RZGHU'DWD7UDQVIHUDQG6WRUDJH +HDUWIHOWWKDQNVWR.D\/RZGHUZKRZDVUHVSRQVLEOHIRURUJDQL]DWLRQDQGDVVHPEO\RI WKHVWRULHV -LP0DXOGLQ (WKQLF/LIH6WRULHV3URMHFW&RRUGLQDWRU The Ethnic Life Stories Project.... .giving the Springfield community a window
    [Show full text]
  • The Crimean Tatar Question: a Prism for Changing Nationalisms and Rival Versions of Eurasianism*
    The Crimean Tatar Question: A Prism for Changing Nationalisms and Rival Versions of Eurasianism* Andrew Wilson Abstract: This article discusses the ongoing debates about Crimean Tatar identity, and the ways in which the Crimean Tatar question has been crucial to processes of reshaping Ukrainian identity during and after the Euromaidan. The Crimean Tatar question, it is argued, is a key test in the struggle between civic and ethnic nationalism in the new Ukraine. The article also looks at the manner in which the proponents of different versions of “Eurasianism”—Russian, Volga Tatar, and Crimean Tatar—have approached the Crimean Tatar question, and how this affects the attitudes of all these ethnic groups to the Russian annexation of Crimea. Key words: Crimean Tatars, Euromaidan, Eurasianism, national identity, nationalism—civic and ethnic Introduction In the period either side of the Russian annexation of Crimea, the Crimean Tatar issue has become a lodestone for redefining the national identities of all the parties involved. The mainstream Crimean Tatar movement has been characterized by steadfast opposition first to the Yanukovych regime in Ukraine and then to Russian rule. This position has strengthened its longstanding ideology of indigenousness and special rights, but it has also * The author is extremely grateful to Ridvan Bari Urcosta for his invaluable help with research for this article, to Bob Deen and Zahid Movlazada at the OSCE HCNM, to Professor Paul Robert Magocsi, and to the anonymous reviewers who made useful comments and criticisms. 1 2 ANDREW WILSON belatedly cemented its alliance with Ukrainian nationalism. Meanwhile, Ukraine’s would‐be new supra‐ethnic civic identity draws heavily on the Crimean Tatar contribution.
    [Show full text]