Anti-Kell (Aa 1-732) Polyclonal Antibody (DBGA- 0203) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Total Page：16

File Type：pdf, Size：1020Kb

Anti-Kell (aa 1-732) polyclonal antibody (DBGA- 0203) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Product Overview Mouse polyclonal to Blood Group Kell Antigen Antigen Description The Kell antigen system (also known as Kell-Cellano system) is a group of antigens on the human red blood cell surface which are important determinants of blood type and are targets for autoimmune or alloimmune diseases which destroy red blood cells. Kell can be noted as K, k, or Kp. The Kell antigens are peptides found within the Kell protein, a 93 kilodalton transmembrane zinc-dependent endopeptidase which is responsible for cleaving endothelin-3. Target Kell Immunogen Full length protein corresponding to Human Blood Group Kell Antigen aa 1-732. Sequence: MEGGDQSEEEPRERSQAGGMGTLWSQESTPEERLPVEGSR PWAVARRVLTAILILGLLLCFSVLLFYNFQNCGPRPCETS VCLDLRDHYLASGNTSVAPCTDFFSFACGRAKETNNSFQE LATKNKNRLRRILEVQNSWHPGSGEEKAFQFYNSCMDTLA IEAAGTGPLRQVIEELGGWRISGKWTSLNFNRTLRLLMSQ YGHFPFFRAYLGPHPASPHTPVIQIDQPEFDVPLKQDQEQ KIYAQIFREYLTYLNQLGTLLGGDPSKVQEHSSLSISITS RLFQFLRPLEQRRAQGKLFQMVTIDQLKEMAPAIDWLSCL QATFTPMSLSPSQSLVVHDVEYLKNMSQLVEEMLLKQRDF LQSHMILGLVVTLSPALDSQFQEARRKLSQKLRELTEQPP Isotype IgG Source/Host Mouse Species Reactivity Human Purification Whole antiserum Conjugate Unconjugated Applications WB Sequence Similarities Belongs to the peptidase M13 family. Cellular Localization Cell membrane. Spans the erythrocyte membrane, and is attached to the underlying 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved cytoskeleton. Positive Control Blood Group Kell Antigen-transfected 293T cell lysate Procedure Blood Group Antibodies Format Liquid Size 50 ul Preservative None Storage Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.

Copy Link

Recommended publications

Human and Mouse CD Marker Handbook Human and Mouse CD Marker Key Markers - Human Key Markers - Mouse
Welcome to More Choice CD Marker Handbook For more information, please visit: Human bdbiosciences.com/eu/go/humancdmarkers Mouse bdbiosciences.com/eu/go/mousecdmarkers Human and Mouse CD Marker Handbook Human and Mouse CD Marker Key Markers - Human Key Markers - Mouse CD3 CD3 CD (cluster of differentiation) molecules are cell surface markers T Cell CD4 CD4 useful for the identification and characterization of leukocytes. The CD CD8 CD8 nomenclature was developed and is maintained through the HLDA (Human Leukocyte Differentiation Antigens) workshop started in 1982. CD45R/B220 CD19 CD19 The goal is to provide standardization of monoclonal antibodies to B Cell CD20 CD22 (B cell activation marker) human antigens across laboratories. To characterize or “workshop” the antibodies, multiple laboratories carry out blind analyses of antibodies. These results independently validate antibody specificity. CD11c CD11c Dendritic Cell CD123 CD123 While the CD nomenclature has been developed for use with human antigens, it is applied to corresponding mouse antigens as well as antigens from other species. However, the mouse and other species NK Cell CD56 CD335 (NKp46) antibodies are not tested by HLDA. Human CD markers were reviewed by the HLDA. New CD markers Stem Cell/ CD34 CD34 were established at the HLDA9 meeting held in Barcelona in 2010. For Precursor hematopoetic stem cell only hematopoetic stem cell only additional information and CD markers please visit www.hcdm.org. Macrophage/ CD14 CD11b/ Mac-1 Monocyte CD33 Ly-71 (F4/80) CD66b Granulocyte CD66b Gr-1/Ly6G Ly6C CD41 CD41 CD61 (Integrin b3) CD61 Platelet CD9 CD62 CD62P (activated platelets) CD235a CD235a Erythrocyte Ter-119 CD146 MECA-32 CD106 CD146 Endothelial Cell CD31 CD62E (activated endothelial cells) Epithelial Cell CD236 CD326 (EPCAM1) For Research Use Only.
[Show full text]
Mcleod Neuroacanthocytosis Syndrome
NCBI Bookshelf. A service of the National Library of Medicine, National Institutes of Health. Pagon RA, Adam MP, Ardinger HH, et al., editors. GeneReviews® [Internet]. Seattle (WA): University of Washington, Seattle; 1993- 2017. McLeod Neuroacanthocytosis Syndrome Hans H Jung, MD Department of Neurology University Hospital Zurich Zurich, Switzerland [email protected] Adrian Danek, MD Neurologische Klinik Ludwig-Maximilians-Universität München, Germany ed.uml@kenad Ruth H Walker, MD, MBBS, PhD Department of Neurology Veterans Affairs Medical Center Bronx, New York [email protected] Beat M Frey, MD Blood Transfusion Service Swiss Red Cross Schlieren/Zürich, Switzerland [email protected] Christoph Gassner, PhD Blood Transfusion Service Swiss Red Cross Schlieren/Zürich, Switzerland [email protected] Initial Posting: December 3, 2004; Last Update: May 17, 2012. Summary Clinical characteristics. McLeod neuroacanthocytosis syndrome (designated as MLS throughout this review) is a multisystem disorder with central nervous system (CNS), neuromuscular, and hematologic manifestations in males. CNS manifestations are a neurodegenerative basal ganglia disease including (1) movement disorders, (2) cognitive alterations, and (3) psychiatric symptoms. Neuromuscular manifestations include a (mostly subclinical) sensorimotor axonopathy and muscle weakness or atrophy of different degrees. Hematologically, MLS is defined as a specific blood group phenotype (named after the first proband, Hugh McLeod) that results from absent expression of the Kx erythrocyte antigen and weakened expression of Kell blood group antigens. The hematologic manifestations are red blood cell acanthocytosis and compensated hemolysis. Allo-antibodies in the Kell and Kx blood group system can cause strong reactions to transfusions of incompatible blood and severe anemia in newborns of Kell-negative mothers.
[Show full text]
Immuno 2014 No. 1
Journal of Blood Group Serology and Molecular Genetics VOLUME 30, N UMBER 1, 2014 Immunohematology Journal of Blood Group Serology and Molecular Genetics Volume 30, Number 1, 2014 CONTENTS R EPORT 1 Indirect antiglobulin test-crossmatch using low-ionic-strength saline–albumin enhancement medium and reduced incubation time: effectiveness in the detection of most clinically significant antibodies and impact on blood utilization C.L. Dinardo, S.L. Bonifácio, and A. Mendrone, Jr. R EV I EW 6 Raph blood group system M. Hayes R EPORT 11 I-int phenotype among three individuals of a Parsi community from Mumbai, India S.R. Joshi C A SE R EPORT 14 Evans syndrome in a pediatric liver transplant recipient with an autoantibody with apparent specificity for the KEL4 (Kpb) antigen S.A. Koepsell, K. Burright-Hittner, and J.D. Landmark R EV I EW 18 JMH blood group system: a review S.T. Johnson R EPORT 24 Demonstration of IgG subclass (IgG1 and IgG3) in patients with positive direct antiglobulin tests A. Singh, A. Solanki, and R. Chaudhary I N M EMOR ia M 28 George Garratty, 1935–2014 Patricia A. Arndt and Regina M. Leger 30 A NNOUNCEMENTS 34 A DVERT I SEMENTS 39 I NSTRUCT I ONS FOR A UTHORS E D I TOR - I N -C H I EF E D I TOR ia L B OA RD Sandra Nance, MS, MT(ASCP)SBB Philadelphia, Pennsylvania Patricia Arndt, MT(ASCP)SBB Paul M. Ness, MD Pomona, California Baltimore, Maryland M A N AG I NG E D I TOR James P.
[Show full text]
3407 M16141436 19 3.Pdf
Immunohematology JOURNAL OF BLOOD GROUP SEROLOGY AND EDUCATION V OLUME 19, NUMBER 3, 2003 Immunohematology JOURNAL OF BLOOD GROUP SEROLOGY AND EDUCATION V OLUME 19, NUMBER 3, 2003 CONTENTS 73 DNA analysis for donor screening of Dombrock blood group antigens J.R. STORRY, C.M.WESTHOFF,D.CHARLES-PIERRE,M.RIOS,K.HUE-ROYE,S.VEGE,S.NANCE, AND M.E. REID 77 Studies on the Dombrock blood group system in non-human primates C. MOGOS,A.SCHAWALDER,G.R. HALVERSON, AND M.E. REID 83 Murine monoclonal antibodies can be used to type RBCs with a positive DAT G.R. HALVERSON,P.HOWARD,H.MALYSKA,E.TOSSAS, AND M.E. REID 86 Rh antigen and phenotype frequencies and probable genotypes for the four main ethnic groups in Port Harcourt, Nigeria Z.A. JEREMIAH AND F.I. BUSERI 89 Antibodies detected in samples from 21,730 pregnant women S. JOVANOVIC-SRZENTIC,M.DJOKIC,N.TIJANIC,R.DJORDJEVIC,N.RIZVAN,D.PLECAS, AND D. FILIMONOVIC 93 BOOK REVIEWS S. GERALD SANDLER,MD THERESA NESTER,MD 95 COMMUNICATIONS Letter to the Editors Letter From the Editors Irregular RBC antibodies in the Ortho Dedication sera of Brazilian pregnant women 97 IN MEMORIAM BERTIL CEDEGREN,MD 98 99 ANNOUNCEMENTS ADVERTISEMENTS 103 INSTRUCTIONS FOR AUTHORS EDITOR-IN-CHIEF MANAGING EDITOR Delores Mallory, MT(ASCP)SBB Mary H. McGinniss,AB, (ASCP)SBB Rockville, Maryland Bethesda, Maryland TECHNICAL EDITOR SENIOR MEDICAL EDITOR Christine Lomas-Francis, MSc Scott Murphy, MD New York, New York Philadelphia, Pennsylvania ASSOCIATE MEDICAL EDITORS S. Gerald Sandler, MD Geralyn Meny, MD Ralph Vassallo, MD Washington, District of Columbia Philadelphia, Pennsylvania Philadelphia, Pennsylvania EDITORIAL BOARD Patricia Arndt, MT(ASCP)SBB W.
[Show full text]
ABO, Rh and Kell) and Ncovid-19 Susceptibility – a Retrospective Observational Study
Relationship between blood group phenotypes (ABO, Rh and Kell) and nCOVID-19 susceptibility – A retrospective observational study. Sudhir Bhandari SMS Medical College and Hospitals, Jaipur, Rajasthan, India Ajeet Singh Shaktawat SMS Medical College and Hospitals, Jaipur, Rajasthan, India Amit Tak ( [email protected] ) SMS Medical College and Hospitals, Jaipur, Rajasthan, India https://orcid.org/0000-0003-2509-2311 Bhoopendra Patel Government Medical College, Barmer, Rajasthan, India Jyotsna Shukla SMS Medical College and Hospitals, Jaipur, Rajasthan, India Sanjay Singhal SMS Medical College and Hospitals, Jaipur, Rajasthan, India Kapil Gupta SMS Medical College and Hospitals, Jaipur, Rajasthan, India Jitendra Gupta SMS Medical College and Hospitals, Jaipur, Rajasthan, India Shivankan Kakkar SMS Medical College and Hospitals, Jaipur, Rajasthan, India Amitabh Dube SMS Medical College and Hospitals, Jaipur, Rajasthan, India Sunita Dia Medstar Washington Hospital Center, Washington DC 20010, USA. Mahendra Dia North Carolina State University, Raleigh, NC 27695-7609, USA. Todd C Wehner North Carolina State University, Raleigh, NC 27695-7609, USA. Research Article Keywords: ABO blood grouping, coronavirus disease, COVID-19, multinomial test Page 1/13 Posted Date: July 10th, 2020 DOI: https://doi.org/10.21203/rs.3.rs-39611/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Page 2/13 Abstract Since the outbreak of coronavirus disease-19 research has been continued to explore multiple facets of the disease. The objective of the present study is to evaluate the relationship between blood group phenotypes and COVID-19 susceptibility. In this hospital based, retrospective observational study 132 COVID-19 patients were enrolled from SMS Medical College and attached Hospitals, Jaipur, India after the proper approval from the institutional ethics committee.
[Show full text]
Inclusion of Additional Reference Reagents in the Existing Collection of WHO International Reference Reagents for Blood Group Genotyping
WHO/BS/2019.2371 ENGLISH ONLY EXPERT COMMITTEE ON BIOLOGICAL STANDARDIZATION Geneva, 21 to 25 October 2019 Inclusion of Additional Reference Reagents in the Existing Collection of WHO International Reference Reagents for Blood Group Genotyping Report of the international collaborative study to evaluate eighteen additional candidates for addition to the existing collection of four WHO International Reference Reagents for blood group genotyping Evgeniya Volkova1, Emilia Sippert1, Meihong Liu1, Teresita Mercado1, Gregory A Denomme2, Orieji Illoh1, Zhugong Liu1, Maria Rios1*, and the Collaborative Study Group3 1 Office of Blood Research and Review, CBER/FDA, Silver Spring, MD, USA. 2 Blood Research Institute and Diagnostic Laboratories, Versiti/BloodCenter of Wisconsin, Milwaukee, WI, USA. * Principal contact: [email protected] 3 Members of the Collaborative Study Group are listed in Appendix 1. NOTE: This document has been prepared for the purpose of inviting comments and suggestions on the proposals contained therein, which will then be considered by the Expert Committee on Biological Standardization (ECBS). Comments MUST be received by 27 September 2019 and should be addressed to the World Health Organization, 1211 Geneva 27, Switzerland, attention: Technologies, Standards and Norms (TSN). Comments may also be submitted electronically to the Responsible Officer: Dr Ivana Knezevic at email: [email protected]. © World Health Organization 2019 All rights reserved. This draft is intended for a restricted audience only, i.e. the individuals and organizations having received this draft. The draft may not be reviewed, abstracted, quoted, reproduced, transmitted, distributed, translated or adapted, in part or in whole, in any form or by any means outside these individuals and organizations (including the organizations' concerned staff and member organizations) without the permission of the World Health Organization.
[Show full text]
Red Blood Cell Antigen Genotyping
Red Blood Cell Antigen Genotyping Testing is useful in determining allelic variants predicting red blood cell (RBC) antigen phenotypes for patients with recent history of transfusion or with conflicting serological antibody results due to partial, variant, or weak expression antigens. Also Tests to Consider useful as an aid in management of hemolytic disease of the fetus and newborn (HDFN). Typical Testing Strategy Disease Overview Phenotype Testing Evaluates specific RBC antigen presence by serology Prevalence and/or Incidence Results can aid in selecting antigen negative RBC units Erythrocyte alloimmunization occurs in up to 58% of sickle cell patients, up to 35% in other transfusion-dependent patients, and in approximately 0.8% of all pregnant Antigen Testing, RBC Phenotype women. Extended 0013020 Method: Hemagglutination Serological testing includes K, Fya, Fyb, Jka, Symptoms Jkb, S, s (k, cellano, testing performed if indicated) to assess maternal or paternal RBC Transfusion reactions or HDFN can occur due to alloimmunization: phenotype status. Antigen Testing, Rh Phenotype 0013019 Intravascular hemolysis: hemoglobinuria, jaundice, shock Extravascular hemolysis: fever and chills Method: Hemagglutination HDFN: fetal hemolytic anemia, hepatosplenomegaly, jaundice, erythroblastosis, Antigen testing for D, C, E, c, and e to assess neurological damage, hydrops fetalis maternal, paternal, or newborn Rh phenotype status Clinical presentation is variable and dependent upon the specific antibody and recipient factors Genotype Testing May help
[Show full text]
Copyrighted Material
P1: SFK/UKS P2: SFK/UKS QC: SFK/UKS T1: SFK Color: 1C ind BLBK321-Paidas September 7, 2010 15:9 Trim: 244mm X 172mm Index Note: Italicized f and t refer to figures and tables, respectably. Abciximab, 207 anti-A, 29 ABO blood group, 28–9 anti-B, 29 ABO hemolytic disease, 29 anti-c, 28 acetaminophen, 45 anticoagulant therapy, 111–43 acidosis, 197 antiplatelet agents, 141 acquired thrombophilia, 68–74. See also low molecular weight heparin, 127–30, inherited thrombophilia 140–41 diagnosis of, 68, 72t for mechanical heart valve incidence of, 68 thromboprophylaxis, 138–43 obstetrical complications, 73 unfractionated heparin, 127, 140–41 pathogenecity, 71 for venous thromboembolism, 111–18 pathophysiology of, 71 for venous thromboembolism in pregnancy, activated partial thromboplastin time (aPTT), 118–36 127, 173 vitamin K antagonists, 139–40 activated protein C (APC), 6, 74–9, 191 anti-D immunoglobulin, 33 activated recombinant factor VII (rFVIIa), 165 antenatal, 33 activation markers, 7 dose regime, 35 acute fatty liver of pregnancy (AFLP), 187 indications for RhD-negative mothers, 35 acute leukemia, 20 antifibrinolytic drugs, 202 ADAMST13 deficiency, 44 anti-Kell, 28 adenosine diphosphate (ADP), 60, 61–2 f antiphospholipid antibody syndrome (APAS), adherent placenta, 169–70 68–74 alpha-delta storage pool deficiency, 165 clinical consequences, 72–3 Alport syndrome, 60 diagnosis of, 68, 72t amegakaryocytic thrombocytopenia, 60 incidence of, 68 amniotic fluid embolism (AFE), 184–5 obstetrical complications, 73 anaphylaxis, 211 pathogenicity, 71 anemia,
[Show full text]
International Society of Blood Transfusion Working Party on Red Cell Immunogenetics and Blood Group Terminology: Cancun Report (2012)
Vox Sanguinis (2014) 107, 90–96 © 2013 International Society of Blood Transfusion SHORT REPORT DOI: 10.1111/vox.12127 International Society of Blood Transfusion Working Party on red cell immunogenetics and blood group terminology: Cancun report (2012) J. R. Storry,1 L. Castilho,2 G. Daniels,3 W. A. Flegel,4 G. Garratty,5 M. de Haas,6 C. Hyland,7 C. Lomas-Francis,8 J. M. Moulds,9 N. Nogues,10 M. L. Olsson,11 J. Poole,3 M. E. Reid,8 P. Rouger,12 E. van der Schoot,4 M. Scott,3 Y. Tani,13 L.-C. Yu,14 S. Wendel,15 C. Westhoff,8 V. Yahalom16 & T. Zelinski17 1Clinical Immunology and Transfusion Medicine, University and Regional Laboratories, Lund, Sweden 2University of Campinas/Hemocentro, Campinas, Brazil 3Bristol Institute for Transfusion Sciences and IBGRL, NHSBT, Bristol, UK 4Clinical Center, Department of Transfusion Medicine, Bethesda, MD, USA 5American Red Cross Blood Services, Pomona, CA, USA 6Sanquin Blood Supply, Diagnostic Services, Amsterdam, the Netherlands 7Australian Red Cross Blood Services, Brisbane, Australia 8New York Blood Center, New York, NY, USA 9LifeShare Blood Centers, Shreveport, LA, USA 10Banc de Sang i Teixits, Barcelona, Spain 11Department of Laboratory Medicine, Division of Haematology and Transfusion Medicine, Lund University, Sweden 12Centre national de Reference pour les Groupes sanguines, Paris, France 13Japanese Red Cross Kinki Block Blood Center, Ibaraki, Japan 14Mackay Memorial Hospital and National Taiwan University, Taipei, Taiwan 15Blood Bank, Hospital Sirio-Libanes, Sao~ Paulo, Brazil 16NBGRL Magen David Adom, Ramat Gan, Israel 17Rh Laboratory, Winnipeg, Manitoba, Canada The International Society of Blood Transfusion Working Party on red cell immuno- genetics and blood group terminology convened during the International congress in Cancun, July 2012.
[Show full text]
An Introduction to Blood Groups
1405153490_4_001.qxd 8/16/06 9:21 AM Page 1 An introduction to blood groups CHAPTER 1 What is a blood group? In 1900, Landsteiner showed that people could be divided into three groups (now called A, B, and O) on the basis of whether their red cells clumped when mixed with separated sera from people. A fourth group (AB) was soon found. This is the origin of the term ‘blood group’. A blood group could be defined as, ‘An inherited character of the red cell surface, detected by a specific alloantibody’. Do blood groups have to be present on red cells? This is the usual meaning, though platelet- and neutrophil-specific antigens might also be called blood groups. In this book only red cell surface antigens are considered. Blood groups do not have to be red cell specific, or even blood cell specific, and most are also detected on other cell types. Blood groups do have to be detected by a specific antibody: polymorphisms suspected of being present on the red cell surface, but only detected by other means, such as DNA sequencing, are not blood groups. Furthermore, the antibodies must be alloantibod- ies, implying that some individuals lack the blood group. Blood group antigens may be: • proteins; • glycoproteins, with the antibody recognising primarily the polypeptide backbone; • glycoproteins, with the antibody recognising the carbohydrate moiety; • glycolipids, with the antibody recognising the carbohydrate portion. Blood group polymorphisms may be as fundamental as representing the presence or absence of the whole macromolecule (e.g. RhD), or as minor as a single amino acid change (e.g.
[Show full text]
Diversity of Blood Groups in Fish & Humans
The Pharma Innovation Journal 2020; 9(6): 538-541 ISSN (E): 2277- 7695 ISSN (P): 2349-8242 NAAS Rating: 5.03 From 3 to 38: diversity of blood groups in fish & TPI 2020; 9(6): 538-541 © 2020 TPI Humans- A mini review www.thepharmajournal.com Received: 12-04-2020 Accepted: 14-05-2020 Sumaira Rashid, Mehak Hafeez, Hussna, Irfan Ahmad, Ashwani Kumar, Sumaira Rashid Oyas A Asimi, SH Baba, Nasir Hussain and Nakeer Razak Division of Fish Genetics and Biotechnology, Faculty of Fisheries, Sher-e-Kashmir University of Abstract Agricultural Sciences & Technology of Blood group systems in animals arise due to the presence or absence of certain inherited antigens on the Kashmir, India surface of their red blood cells. With the first discovery of blood groups in humans in 1900, several other Mehak Hafeez blood groups have been discovered in different animals including fish. The blood group systems have Division of Fish Genetics and been found in different fish species like goldfish, salmon, tuna, herring, cod, red crucian carp, trout and Biotechnology, Faculty of Fisheries, Sher-e-Kashmir University of spiny dogfish. To date, there are shreds of evidence of only three blood groups in fishes: S system for Agricultural Sciences & Technology of pacific salmon, trout, cod, spiny dogfish and red crucian carp, Tg system for tuna, and Y system for Kashmir, India skipjack tuna. In humans, 38 blood group systems are known to exist, 9 of which are considered to be Hussna major blood group systems; ABO being the most important. The genes of these blood groups are Division of Fish Genetics and autosomal, except XG and XK which are X borne, and MIC2 which is present on both X and Y Biotechnology, Faculty of Fisheries, chromosomes.
[Show full text]
Obstetrics and Gynecology, Howard C
Red Cell Alloimmunization Chapter 34 KeNNeth J. MOISe Jr Nomenclature 770 Indications 774 Hemolytic Disease of the Fetus Historic Perspectives 770 Diagnostic Methods 776 and Newborn Due to Non-RhD Incidence 771 Clinical Management 778 Antibodies 781 Pathophysiology 771 First Affected Pregnancy 778 Rhc 781 Rhesus Alloimmunization and Fetal/ Previously Affected Fetus or Infant 778 RhC, RhE, and Rhe 782 Neonatal Hemolytic Disease of the Intrauterine Transfusion 778 Duffy 782 Newborn 772 Technique 778 Kidd 782 Genetics 772 Complications and Outcome 780 Kell 782 Prevention of RhD Hemolytic Disease Neonatal Transfusions 780 in the Fetus and Newborn 773 Neurologic Outcome 780 History 773 Other Treatment Modalities 780 Preparations 773 Future Therapeutic Options 781 KEY ABBREVIATIONS these antibodies across the placenta during pregnancy results in fetal anemia, hyperbilirubinemia, and ultimately hydrops American Association of Blood Banks AABB fetalis. Before the advent of obstetric ultrasound, the perinatal American College of Obstetricians and ACOG effects of maternal red cell alloimmunization could be recog- Gynecologists nized only after birth in the affected neonate. Thus the neonatal Cytomegalovirus CMV consequences of maternal red cell alloimmunization came to be Circulating cell-free fetal DNA ccffDNA known as hemolytic disease of the newborn (HDN). Because the Deoxyribonucleic acid DNA peripheral blood smear of these infants demonstrated a large Diphosphatidylglycerol DPG percentage of circulating immature red cells known as erythro Fetal blood sampling FBS blasts, the newborn entity was also known as erythroblastosis Fetomaternal hemorrhage FMH fetalis. Today, ultrasound and fetal blood sampling (FBS) make Grams per deciliter g/dL the detection of the severely anemic fetus a reality.
[Show full text]