
Anti-Kell (aa 1-732) polyclonal antibody (DBGA- 0203) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Product Overview Mouse polyclonal to Blood Group Kell Antigen Antigen Description The Kell antigen system (also known as Kell-Cellano system) is a group of antigens on the human red blood cell surface which are important determinants of blood type and are targets for autoimmune or alloimmune diseases which destroy red blood cells. Kell can be noted as K, k, or Kp. The Kell antigens are peptides found within the Kell protein, a 93 kilodalton transmembrane zinc-dependent endopeptidase which is responsible for cleaving endothelin-3. Target Kell Immunogen Full length protein corresponding to Human Blood Group Kell Antigen aa 1-732. Sequence: MEGGDQSEEEPRERSQAGGMGTLWSQESTPEERLPVEGSR PWAVARRVLTAILILGLLLCFSVLLFYNFQNCGPRPCETS VCLDLRDHYLASGNTSVAPCTDFFSFACGRAKETNNSFQE LATKNKNRLRRILEVQNSWHPGSGEEKAFQFYNSCMDTLA IEAAGTGPLRQVIEELGGWRISGKWTSLNFNRTLRLLMSQ YGHFPFFRAYLGPHPASPHTPVIQIDQPEFDVPLKQDQEQ KIYAQIFREYLTYLNQLGTLLGGDPSKVQEHSSLSISITS RLFQFLRPLEQRRAQGKLFQMVTIDQLKEMAPAIDWLSCL QATFTPMSLSPSQSLVVHDVEYLKNMSQLVEEMLLKQRDF LQSHMILGLVVTLSPALDSQFQEARRKLSQKLRELTEQPP Isotype IgG Source/Host Mouse Species Reactivity Human Purification Whole antiserum Conjugate Unconjugated Applications WB Sequence Similarities Belongs to the peptidase M13 family. Cellular Localization Cell membrane. Spans the erythrocyte membrane, and is attached to the underlying 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved cytoskeleton. Positive Control Blood Group Kell Antigen-transfected 293T cell lysate Procedure Blood Group Antibodies Format Liquid Size 50 ul Preservative None Storage Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages2 Page
-
File Size-