S100A5 (Human) Recombinant Protein

Total Page：16

File Type：pdf, Size：1020Kb

S100A5 (Human) Recombinant Gene Symbol: S100A5 Protein Gene Alias: S100D Catalog Number: P3571 Gene Summary: The protein encoded by this gene is a member of the S100 family of proteins containing 2 Regulation Status: For research use only (RUO) EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide Product Description: Human S100A5 (NP_002953, 1 range of cells, and involved in the regulation of a number a.a. - 92 a.a.) full-length recombinant protein with His tag of cellular processes such as cell cycle progression and expressed in Escherichia coli. differentiation. S100 genes include at least 13 members Sequence: which are located as a cluster on chromosome 1q21. MGSSHHHHHHSSGLVPRGSHMETPLEKALTTMVTTF This protein has a Ca2+ affinity 20- to 100-fold higher HKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDD than the other S100 proteins studied under identical LMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDN conditions. This protein also binds Zn2+ and Cu2+, and K Cu2+ strongly which impairs the binding of Ca2+. This protein is expressed in very restricted regions of the Host: Escherichia coli adult brain. [provided by RefSeq] Theoretical MW (kDa): 12.9 Applications: SDS-PAGE (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Form: Liquid Preparation Method: Escherichia coli expression system Purification: Conventional Chromatography Concentration: 0.5 mg/mL Purity: > 90% by SDS-PAGE Storage Buffer: In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (1 mM DTT, 30% glycerol, 0.1 mM PMSF). Storage Instruction: Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 6276 Page 1/1 Powered by TCPDF (www.tcpdf.org).

Copy Link

Recommended publications

Fine Mapping Studies of Quantitative Trait Loci for Baseline Platelet Count in Mice and Humans
Fine mapping studies of quantitative trait loci for baseline platelet count in mice and humans A thesis submitted in fulfillment of the requirements for the degree of Doctor of Philosophy Melody C Caramins December 2010 University of New South Wales ORIGINALITY STATEMENT ‘I hereby declare that this submission is my own work and to the best of my knowledge it contains no materials previously published or written by another person, or substantial proportions of material which have been accepted for the award of any other degree or diploma at UNSW or any other educational institution, except where due acknowledgement is made in the thesis. Any contribution made to the research by others, with whom I have worked at UNSW or elsewhere, is explicitly acknowledged in the thesis. I also declare that the intellectual content of this thesis is the product of my own work, except to the extent that assistance from others in the project's design and conception or in style, presentation and linguistic expression is acknowledged.’ Signed …………………………………………….............. Date …………………………………………….............. This thesis is dedicated to my father. Dad, thanks for the genes – and the environment! ACKNOWLEDGEMENTS “Nothing can come out of nothing, any more than a thing can go back to nothing.” - Marcus Aurelius Antoninus A PhD thesis is never the work of one person in isolation from the world at large. I would like to thank the following people, without whom this work would not have existed. Thank you firstly, to all my teachers, of which there have been many. Undoubtedly, the greatest debt is owed to my supervisor, Dr Michael Buckley.
[Show full text]
Jiang Et Al., 2015. Molecular [Profiling of Activated Olfactory Neurons
ART ic LE s Molecular profiling of activated olfactory neurons identifies odorant receptors for odors in vivo Yue Jiang1–3, Naihua Natalie Gong1, Xiaoyang Serene Hu1, Mengjue Jessica Ni1, Radhika Pasi1 & Hiroaki Matsunami1,4 The mammalian olfactory system uses a large family of odorant receptors (ORs) to detect and discriminate amongst a myriad of volatile odor molecules. Understanding odor coding requires comprehensive mapping between ORs and corresponding odors. We developed a means of high-throughput in vivo identification of OR repertoires responding to odorants using phosphorylated ribosome immunoprecipitation of mRNA from olfactory epithelium of odor-stimulated mice followed by RNA-Seq. This approach screened the endogenously expressed ORs against an odor in one set of experiments using awake and freely behaving mice. In combination with validations in a heterologous system, we identified sets of ORs for two odorants, acetophenone and 2,5-dihydro-2,4,5-trimethylthiazoline (TMT), encompassing 69 OR-odorant pairs. We also identified shared amino acid residues specific to the acetophenone or TMT receptors and developed models to predict receptor activation by acetophenone. Our results provide a method for understanding the combinatorial coding of odors in vivo. In mammals, olfactory sensation starts with the detection of odor lig- early gene expression, such as c-Fos and Egr-1, which is widely used ands predominantly by ORs, a large family of seven transmembrane G to mark active neurons15,18,19. However, unlike immediate early gene protein–coupled receptors (GPCRs)1,2. ORs are individually expressed expression, phosphorylated S6 has the advantage of being physically in olfactory sensory neurons (OSNs) located in the olfactory epithe- associated with mRNA species expressed in the activated neurons.
[Show full text]
Definition of the Landscape of Promoter DNA Hypomethylation in Liver Cancer
Published OnlineFirst July 11, 2011; DOI: 10.1158/0008-5472.CAN-10-3823 Cancer Therapeutics, Targets, and Chemical Biology Research Definition of the Landscape of Promoter DNA Hypomethylation in Liver Cancer Barbara Stefanska1, Jian Huang4, Bishnu Bhattacharyya1, Matthew Suderman1,2, Michael Hallett3, Ze-Guang Han4, and Moshe Szyf1,2 Abstract We use hepatic cellular carcinoma (HCC), one of the most common human cancers, as a model to delineate the landscape of promoter hypomethylation in cancer. Using a combination of methylated DNA immunopre- cipitation and hybridization with comprehensive promoter arrays, we have identified approximately 3,700 promoters that are hypomethylated in tumor samples. The hypomethylated promoters appeared in clusters across the genome suggesting that a high-level organization underlies the epigenomic changes in cancer. In normal liver, most hypomethylated promoters showed an intermediate level of methylation and expression, however, high-CpG dense promoters showed the most profound increase in gene expression. The demethylated genes are mainly involved in cell growth, cell adhesion and communication, signal transduction, mobility, and invasion; functions that are essential for cancer progression and metastasis. The DNA methylation inhibitor, 5- aza-20-deoxycytidine, activated several of the genes that are demethylated and induced in tumors, supporting a causal role for demethylation in activation of these genes. Previous studies suggested that MBD2 was involved in demethylation of specific human breast and prostate cancer genes. Whereas MBD2 depletion in normal liver cells had little or no effect, we found that its depletion in human HCC and adenocarcinoma cells resulted in suppression of cell growth, anchorage-independent growth and invasiveness as well as an increase in promoter methylation and silencing of several of the genes that are hypomethylated in tumors.
[Show full text]
Human S100A5 Circulex Product Data Sheet for Research Use Only, Not for Use in Diagnostic Procedures
TM Human S100A5 CircuLex Product Data Sheet For Research Use Only, Not for use in diagnostic procedures Human S100A5 Human, recombinant protein expressed in E. coli. Cat# CY-R2255 Amount: 100 µg (1.0 µg/µl) Lot: Introduction: The protein S100A5, formerly called S100D, was recognized for the first time as the product of one of the tightest gene clusters discovered in the human genome located on chromosome 1q21. S100A5 is a member of the EF-hand superfamily of calcium-binding proteins that is poorly characterized at the protein level. Immunohistochemical analysis demonstrates that it is expressed in very restricted regions of the adult brain and Henle portion of kidney. The homodimeric S100A5 binds four Ca2+ ions with strong positive cooperativity and an affinity 20-100-fold higher than the other S100 proteins studied under identical conditions. S100A5 also binds two Zn2+ ions and four Cu2+ ions per dimer. Cu2+ binding strongly impairs the binding of Ca2+. Product Description: Full length of human S100A5, containing an N-terminal GST tag, expressed in E. coil. and purified by GSH agarose chromatography. Gene Information: The gene accession number is NM_002962. Gene Aliases: S100D Formulation: Recombinant human S100A5 is supplied frozen in 2X PBS (2X phosphate buffered saline) containing 50 % glycerol. Cat#: CY-R2255 1 Version#: 120420 For Reference Purpose Only! TM Human S100A5 CircuLex Product Data Sheet For Research Use Only, Not for use in diagnostic procedures Molecular Weight: 36 kDa Recombinant human S100A5 demonstrates approximately 36 kDa band by Mw (kDa) SDS-PAGE analysis. 97 Purity is over 90 % estimated by SDS-PAGE analysis.
[Show full text]
Atlas Journal
Atlas of Genetics and Cytogenetics in Oncology and Haematology Home Genes Leukemias Solid Tumours Cancer-Prone Deep Insight Portal Teaching X Y 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 NA Atlas Journal Atlas Journal versus Atlas Database: the accumulation of the issues of the Journal constitutes the body of the Database/Text-Book. TABLE OF CONTENTS Volume 12, Number 6, Nov-Dec 2008 Previous Issue / Next Issue Genes BCL8 (B-cell CLL/lymphoma 8) (15q11). Silvia Rasi, Gianluca Gaidano. Atlas Genet Cytogenet Oncol Haematol 2008; 12 (6): 781-784. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/BCL8ID781ch15q11.html CDC25A (Cell division cycle 25A) (3p21). Dipankar Ray, Hiroaki Kiyokawa. Atlas Genet Cytogenet Oncol Haematol 2008; 12 (6): 785-791. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/CDC25AID40004ch3p21.html CDC73 (cell division cycle 73, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)) (1q31.2). Leslie Farber, Bin Tean Teh. Atlas Genet Cytogenet Oncol Haematol 2008; 12 (6): 792-797. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/CDC73D181ch1q31.html EIF3C (eukaryotic translation initiation factor 3, subunit C) (16p11.2). Daniel R Scoles. Atlas Genet Cytogenet Oncol Haematol 2008; 12 (6): 798-802. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/EIF3CID44187ch16p11.html ELAC2 (elaC homolog 2 (E. coli)) (17p11.2). Yang Chen, Sean Tavtigian, Donna Shattuck. Atlas Genet Cytogenet Oncol Haematol 2008; 12 (6): 803-806. [Full Text] [PDF] URL : http://atlasgeneticsoncology.org/Genes/ELAC2ID40437ch17p11.html FOXM1 (forkhead box M1) (12p13). Jamila Laoukili, Monica Alvarez Fernandez, René H Medema.
[Show full text]
Semiochemical Responsive Olfactory Sensory Neurons Are Sexually
RESEARCH ARTICLE Semiochemical responsive olfactory sensory neurons are sexually dimorphic and plastic Aashutosh Vihani1*, Xiaoyang Serene Hu2, Sivaji Gundala3, Sachiko Koyama4, Eric Block3, Hiroaki Matsunami1,2,5* 1Department of Neurobiology, Neurobiology Graduate Program, Duke University Medical Center, Durham, United States; 2Department of Molecular Genetics and Microbiology, Duke University Medical Center, Durham, United States; 3Department of Chemistry, University at Albany, State University of New York, Albany, United States; 4School of Medicine, Medical Sciences, Indiana University, Bloomington, United States; 5Duke Institute for Brain Sciences, Duke University, Durham, United States Abstract Understanding how genes and experience work in concert to generate phenotypic variability will provide a better understanding of individuality. Here, we considered this in the main olfactory epithelium, a chemosensory structure with over a thousand distinct cell types in mice. We identified a subpopulation of olfactory sensory neurons, defined by receptor expression, whose abundances were sexually dimorphic. This subpopulation of olfactory sensory neurons was over- represented in sex-separated mice and robustly responsive to sex-specific semiochemicals. Sex- combined housing led to an attenuation of the dimorphic representations. Single-cell sequencing analysis revealed an axis of activity-dependent gene expression amongst a subset of the dimorphic OSN populations. Finally, the pro-apoptotic gene Baxwas necessary to generate the dimorphic
[Show full text]
S100 Calcium Binding Protein Family Members Associate with Poor Patient Outcome and Response to Proteasome Inhibition in Multiple Myeloma
fcell-09-723016 August 10, 2021 Time: 12:24 # 1 ORIGINAL RESEARCH published: 16 August 2021 doi: 10.3389/fcell.2021.723016 S100 Calcium Binding Protein Family Members Associate With Poor Patient Outcome and Response to Proteasome Inhibition in Multiple Myeloma Minxia Liu1†, Yinyin Wang2†, Juho J. Miettinen1, Romika Kumari1, Muntasir Mamun Majumder1, Ciara Tierney3,4, Despina Bazou3, Alun Parsons1, Edited by: Minna Suvela1, Juha Lievonen5, Raija Silvennoinen5, Pekka Anttila5, Paul Dowling4, Lawrence H. Boise, Peter O’Gorman3, Jing Tang2 and Caroline A. Heckman1* Emory University, United States Reviewed by: 1 Institute for Molecular Medicine Finland – FIMM, HiLIFE – Helsinki Institute of Life Science, iCAN Digital Cancer Medicine Paola Neri, Flagship, University of Helsinki, Helsinki, Finland, 2 Research Program in Systems Oncology, Faculty of Medicine, University University of Calgary, Canada of Helsinki, Helsinki, Finland, 3 Department of Hematology, Mater Misericordiae University Hospital, Dublin, Ireland, Linda B. Baughn, 4 Department of Biology, National University of Ireland, Maynooth, Ireland, 5 Department of Hematology, Helsinki University Mayo Clinic, United States Hospital Comprehensive Cancer Center, University of Helsinki, Helsinki, Finland *Correspondence: Caroline A. Heckman Despite several new therapeutic options, multiple myeloma (MM) patients experience caroline.heckman@helsinki.fi multiple relapses and inevitably become refractory to treatment. Insights into drug †These authors have contributed equally to this work and share first resistance mechanisms may lead to the development of novel treatment strategies. authorship The S100 family is comprised of 21 calcium binding protein members with 17 S100 genes located in the 1q21 region, which is commonly amplified in MM. Dysregulated Specialty section: This article was submitted to expression of S100 family members is associated with tumor initiation, progression and Cell Death and Survival, inflammation.
[Show full text]
Concentration-Dependent Recruitment of Mammalian Odorant Receptors
Research Article: New Research Sensory and Motor Systems Concentration-Dependent Recruitment of Mammalian Odorant Receptors Xiaoyang Serene Hu,1 Kentaro Ikegami,1,2 Aashutosh Vihani,1,3 Kevin W. Zhu,1 Marcelo Zapata,1 Claire A. de March,1 Matthew Do,1 Natasha Vaidya,1,4 Gary Kucera,5 Cheryl Bock,5 Yue Jiang,1 Masafumi Yohda,2 and Hiroaki Matsunami1,3 https://doi.org/10.1523/ENEURO.0103-19.2019 1Department of Molecular Genetics and Microbiology, Duke University Medical Center, Durham, NC 27710, 2Tokyo University of Agriculture and Technology, Tokyo 183-8538, Japan, 3Department of Neurobiology, Duke Institute for Brain Sciences, Duke University, Durham, NC 27710, 4North Carolina School of Science and Mathematics, Durham, NC 27705, and 5DCI Rodent Cancer Models Shared Resource, Duke University Medical Center, Durham, NC 27710 Abstract A fundamental challenge in studying principles of organization used by the olfactory system to encode odor concentration information has been identifying comprehensive sets of activated odorant receptors (ORs) across a broad concentration range inside freely behaving animals. In mammals, this has recently become fea- sible with high-throughput sequencing-based methods that identify populations of activated ORs in vivo.In this study, we characterized the mouse OR repertoires activated by the two odorants, acetophenone (ACT) and 2,5-dihydro-2,4,5-trimethylthiazoline (TMT), from 0.01% to 100% (v/v) as starting concentrations using phosphorylated ribosomal protein S6 capture followed by RNA-Seq. We found Olfr923 to be one of the most sensitive ORs that is enriched by ACT. Using a mouse line that genetically labels Olfr923-positive axons, we provided evidence that ACT activates the Olfr923 glomeruli in the olfactory bulb.
[Show full text]
Zimmer Cell Calcium 2013 Mammalian S100 Evolution.Pdf
Cell Calcium 53 (2013) 170–179 Contents lists available at SciVerse ScienceDirect Cell Calcium jo urnal homepage: www.elsevier.com/locate/ceca Evolution of the S100 family of calcium sensor proteins a,∗ b b,1 b Danna B. Zimmer , Jeannine O. Eubanks , Dhivya Ramakrishnan , Michael F. Criscitiello a Center for Biomolecular Therapeutics and Department of Biochemistry & Molecular Biology, University of Maryland School of Medicine, 108 North Greene Street, Baltimore, MD 20102, United States b Comparative Immunogenetics Laboratory, Department of Veterinary Pathobiology, College of Veterinary Medicine & Biomedical Sciences, Texas A&M University, College Station, TX 77843-4467, United States a r t i c l e i n f o a b s t r a c t 2+ Article history: The S100s are a large group of Ca sensors found exclusively in vertebrates. Transcriptomic and genomic Received 4 October 2012 data from the major radiations of mammals were used to derive the evolution of the mammalian Received in revised form 1 November 2012 S100s genes. In human and mouse, S100s and S100 fused-type proteins are in a separate clade from Accepted 3 November 2012 2+ other Ca sensor proteins, indicating that an ancient bifurcation between these two gene lineages Available online 14 December 2012 has occurred. Furthermore, the ﬁve genomic loci containing S100 genes have remained largely intact during the past 165 million years since the shared ancestor of egg-laying and placental mammals. Keywords: Nonetheless, interesting births and deaths of S100 genes have occurred during mammalian evolution. Mammals The S100A7 loci exhibited the most plasticity and phylogenetic analyses clariﬁed relationships between Phylogenetic analyses the S100A7 proteins encoded in the various mammalian genomes.
[Show full text]
(12) Patent Application Publication (10) Pub. No.: US 2003/0198970 A1 Roberts (43) Pub
US 2003O19897OA1 (19) United States (12) Patent Application Publication (10) Pub. No.: US 2003/0198970 A1 Roberts (43) Pub. Date: Oct. 23, 2003 (54) GENOSTICS clinical trials on groups or cohorts of patients. This group data is used to derive a Standardised method of treatment (75) Inventor: Gareth Wyn Roberts, Cambs (GB) which is Subsequently applied on an individual basis. There is considerable evidence that a significant factor underlying Correspondence Address: the individual variability in response to disease, therapy and FINNEGAN, HENDERSON, FARABOW, prognosis lies in a person's genetic make-up. There have GARRETT & DUNNER been numerous examples relating that polymorphisms LLP within a given gene can alter the functionality of the protein 1300 ISTREET, NW encoded by that gene thus leading to a variable physiological WASHINGTON, DC 20005 (US) response. In order to bring about the integration of genomics into medical practice and enable design and building of a (73) Assignee: GENOSTIC PHARMA LIMITED technology platform which will enable the everyday practice (21) Appl. No.: 10/206,568 of molecular medicine a way must be invented for the DNA Sequence data to be aligned with the identification of genes (22) Filed: Jul. 29, 2002 central to the induction, development, progression and out come of disease or physiological States of interest. Accord Related U.S. Application Data ing to the invention, the number of genes and their configu rations (mutations and polymorphisms) needed to be (63) Continuation of application No. 09/325,123, filed on identified in order to provide critical clinical information Jun. 3, 1999, now abandoned. concerning individual prognosis is considerably less than the 100,000 thought to comprise the human genome.
[Show full text]
UNIVERSITY of CALIFORNIA, IRVINE Gene Regulatory
UNIVERSITY OF CALIFORNIA, IRVINE Gene Regulatory Mechanisms in Epithelial Specification and Function DISSERTATION submitted in partial satisfaction of the requirements for the degree of DOCTOR OF PHILOSOPHY in Biomedical Sciences by Rachel Herndon Klein Dissertation Committee: Professor Bogi Andersen, M.D., Chair Professor Xing Dai, Ph.D. Professor Anand Ganesan, M.D. Professor Ali Mortazavi, Ph.D Professor Kyoko Yokomori, Ph.D 2015 © 2015 Rachel Herndon Klein DEDICATION To My parents, my sisters, my husband, and my friends for your love and support, and to Ben with all my love. ii TABLE OF CONTENTS Page LIST OF FIGURES iv LIST OF TABLES vi ACKNOWLEDGMENTS vii CURRICULUM VITAE viii-ix ABSTRACT OF THE DISSERTATION x-xi CHAPTER 1: INTRODUCTION 1 CHAPTER 2: Cofactors of LIM domain (CLIM) proteins regulate corneal epithelial progenitor cell function through noncoding RNA H19 22 CHAPTER 3: KLF7 regulates the corneal epithelial progenitor cell state acting antagonistically to KLF4 49 CHAPTER 4: GRHL3 interacts with super enhancers and the neuronal repressor REST to regulate keratinocyte differentiation and migration 77 CHAPTER 5: Methods 103 CHAPTER 6: Summary and Conclusions 111 REFERENCES 115 iii LIST OF FIGURES Page Figure 1-1. Structure and organization of the epidermis. 3 Figure 1-2. Structure of the limbus, and cornea epithelium. 4 Figure 1-3. Comparison of H3K4 methylating SET enzymes between S. cerevisiae, D. melanogaster, and H. sapiens. 18 Figure 1-4. The WRAD complex associates with Trithorax SET enzymes. 18 Figure 1-5. Model for GRHL3, PcG, and TrX –mediated regulation of epidermal differentiation genes. 19 Figure 2-1. Microarray gene expression analysis of postnatal day 3 (P3) whole mouse corneas reveals genes and pathways with altered expression in K14-DN-Clim mice.
[Show full text]
Transcriptional Profiling Reveals TRPM5-Expressing Cells Involved in Viral Infection in The
bioRxiv preprint doi: https://doi.org/10.1101/2020.05.14.096016; this version posted May 15, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. 1 Transcriptional profiling reveals TRPM5-expressing cells involved in viral infection in the 2 olfactory epithelium 3 4 B. Dnate’ Baxter1,2,‡, Eric D. Larson3 ‡, Paul Feinstein4, Arianna Gentile Polese1,2, Andrew N. 5 Bubak5, Christy S. Niemeyer5, Laetitia Merle1,2, Doug Shepherd6, Vijay R. Ramakrishnan3, 6 Maria A. Nagel5, and Diego Restrepo1,2,* 7 8 1Neuroscience Graduate Program, University of Colorado Anschutz Medical Campus, Aurora, 9 CO 80045, USA 10 2Department of Cell and Developmental Biology, University of Colorado Anschutz Medical 11 Campus, Aurora, CO 80045, USA 12 3Department of Otolaryngology, University of Colorado Anschutz Medical Campus, Aurora, CO 13 80045, USA 14 4Department of Biological Sciences, Hunter College, CUNY, New York, NY, 10065, USA 15 5Department of Neurology, University of Colorado Anschutz Medical Campus, Aurora, CO 16 80045, USA 17 6Department of Pharmacology, University of Colorado Anschutz Medical Campus and 18 Center for Biological Physics and Department of Physics, Arizona State University, USA 19 20 21 22 ‡Co-first authors 23 *Corresponding author: Diego Restrepo, [email protected] 24 bioRxiv preprint doi: https://doi.org/10.1101/2020.05.14.096016; this version posted May 15, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. 25 Understanding viral infection of the olfactory epithelium is essential because smell loss can 26 occur with coronavirus disease 2019 (COVID-19), caused by severe acute respiratory syndrome 27 coronavirus clade 2 (SARS-CoV-2), and because the olfactory nerve is an important route of 28 entry for viruses to the central nervous system.
[Show full text]