S100A5 (Human) Recombinant Gene Symbol: S100A5 Protein Gene Alias: S100D Catalog Number: P3571 Gene Summary: The protein encoded by this gene is a member of the S100 family of proteins containing 2 Regulation Status: For research use only (RUO) EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide Product Description: Human S100A5 (NP_002953, 1 range of cells, and involved in the regulation of a number a.a. - 92 a.a.) full-length recombinant protein with His tag of cellular processes such as cell cycle progression and expressed in Escherichia coli. differentiation. S100 genes include at least 13 members Sequence: which are located as a cluster on chromosome 1q21. MGSSHHHHHHSSGLVPRGSHMETPLEKALTTMVTTF This protein has a Ca2+ affinity 20- to 100-fold higher HKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDD than the other S100 proteins studied under identical LMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDN conditions. This protein also binds Zn2+ and Cu2+, and K Cu2+ strongly which impairs the binding of Ca2+. This protein is expressed in very restricted regions of the Host: Escherichia coli adult brain. [provided by RefSeq] Theoretical MW (kDa): 12.9 Applications: SDS-PAGE (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Form: Liquid Preparation Method: Escherichia coli expression system Purification: Conventional Chromatography Concentration: 0.5 mg/mL Purity: > 90% by SDS-PAGE Storage Buffer: In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (1 mM DTT, 30% glycerol, 0.1 mM PMSF). Storage Instruction: Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 6276 Page 1/1 Powered by TCPDF (www.tcpdf.org).