Diagnosis, Management and Therapeutic Strategies for Congenital

Total Page:16

File Type:pdf, Size:1020Kb

Diagnosis, Management and Therapeutic Strategies for Congenital Review Diagnosis, management and therapeutic Heart: first published as 10.1136/heartjnl-2020-318259 on 26 May 2021. Downloaded from strategies for congenital long QT syndrome Arthur A M Wilde , Ahmad S Amin, Pieter G Postema Heart Centre, Department ABSTRACT Diagnosis of Cardiology, Amsterdam Congenital long QT syndrome (LQTS) is characterised The diagnosis of LQTS relies on the heart rate Universitair Medische Centra, Amsterdam, The Netherlands by heart rate corrected QT interval prolongation and corrected QT interval (QTc) and on a number of life- threatening arrhythmias, leading to syncope and other electrocardiographic parameters as well as Correspondence to sudden death. Variations in genes encoding for cardiac elements obtained by history taking (eg, symptoms Professor Arthur A M Wilde, ion channels, accessory ion channel subunits or proteins and family history). Together they form the LQTS Amsterdam Universitair modulating the function of the ion channel have been probability or Schwartz score, where a score of Medische Centra, Amsterdam, identified as disease-causing mutations in up to 75% of ≥3.5 points indicates a high probability of LQTS The Netherlands; 2 3 a. a. wilde@ amsterdamumc. nl all LQTS cases. Based on the underlying genetic defect, (figures 1 and 2). Genetic information is not LQTS has been subdivided into different subtypes. part of the Schwartz score but an individual with Received 25 January 2021 Growing insights into the genetic background and a pathogenic variant also fulfills the current diag- Revised 12 April 2021 pathophysiology of LQTS has led to the identification nostic criteria for LQTS.3 It is important to realise Accepted 3 May 2021 of genotype–phenotype relationships for the most that the QTc of individuals with pathogenic variants common genetic subtypes, the recognition of genetic and normal healthy controls significantly overlap, and non-genetic modifiers of phenotype, optimisation indicating that a single QTc will never be able to of risk stratification algorithms and the discovery of distinguish all non- LQTS ECGs from all LQTS gene-specific therapies in LQTS. Nevertheless, despite ECGs.4 5 It is also important to realise that there these great advancements in the LQTS field, large are different methods to measure the QT interval, gaps in knowledge still exist. For example, up to 25% which need different cut- off values, and that the of LQTS cases still remain genotype elusive, which formulas for heart rate correction are imperfect hampers proper identification of family members at and also result in different cut-off values.5 In addi- risk, and it is still largely unknown what determines the tion, although the U- wave can also be abnormal in large variability in disease severity, where even within LQTS patients, the U- wave should not be included one family an identical mutation causes malignant in the QT assessment.6 Based on ECGs of a large arrhythmias in some carriers, while in other carriers, the number of genotyped LQTS patients and their disease is clinically silent. In this review, we summarise family members not carrying the familial variant, the current evidence available on the diagnosis, clinical we designed an online calculator with information http://heart.bmj.com/ management and therapeutic strategies in LQTS. on the likelihood that LQTS is present based on We also discuss new scientific developments and the calculated QTc (https://www. qtcalculator.org). 5 areas of research, which are expected to increase our In the past years, additional tools to more reliably understanding of the complex genetic architecture assess LQTS on the ECG have been developed,7–9 in genotype-negative patients, lead to improved risk including the use of artificial intelligence in estab- stratification in asymptomatic mutation carriers and lishing the diagnosis.10 more targeted (gene-specific and even mutation-specific) therapies. on October 2, 2021 by guest. Protected copyright. Genotyping and genotype–phenotype INTRODUCTION correlations Congenital Long QT Syndrome (LQTS), as the In the last 25 years, 17 genes have been associ- name implies, is characterised by a prolonged QT ated with LQTS. However, a recent analysis, based interval on the ECG, in the absence of structural on an approach using gene and disease specific heart disease and external factors such as a variety metrics designed by the Clinical Genome Resource of drugs.1–3 LQTS was first described in the 1950s (ClinGen), reclassified a number of these genes to of the previous century, initially in a family with limited or disputed evidence.11 This approach left deafness (ie, Jervell and Lange- Nielsen syndrome). seven genes with definitive or strong evidence for A few years later, in the early 1960s, patients with causality (table 1).11 These remaining genes all a similar ECG abnormality but without deafness encode for ion channels involved in cardiac repo- were described (ie, Romano- Ward syndrome). larisation, their modulatory subunits or proteins © Author(s) (or their Although initially this disease was subdivided into regulating or modulating the function of ion chan- employer(s)) 2021. Re- use permitted under CC BY. these two entities, later in time the more general nels. A positive genotype result, which is obtained Published by BMJ. terminology LQTS was used, and more recently in up to 75% of individuals with a clear phenotype, (1995–1996), it became clear that, based on the is of importance because it significantly contrib- To cite: Wilde AAM, underlying genetic defect, a further subdivision utes to risk and different aspects of the treatment Amin AS, Postema PG. 2 3 Heart Epub ahead of into distinct subtypes is pertinent. The various strategy. print: [please include Day milestones in the over 60 years history of this Indeed, specific genotype–phenotype rela- Month Year]. doi:10.1136/ disease are nicely summarised in a recent personal tionships have been described for the three most heartjnl-2020-318259 review by Dr Schwartz.3 common subtypes: LQTS types 1, 2 and 3 (figure 3). Wilde AAM, et al. Heart 2021;0:1–7. doi:10.1136/heartjnl-2020-318259 1 Review Heart: first published as 10.1136/heartjnl-2020-318259 on 26 May 2021. Downloaded from Figure 2 Schematic flow chart for the diagnosis LQTS. Flow chart for the diagnosis of LQTS following the Heart Rhythm Society/European Heart Rhythm Association/Asian Pacific Heart Rhythm Society consensus document from 2013.3 The LQTS risk score (ie, the ‘Schwartz score’) is presented in figure 1. *QTc calculated by Bazett formula (QTc=QT/√RR). LQTS, long QT syndrome; QTc, corrected QT interval. potential prolongation results in early afterdepolarisations that at one instant reach threshold for subsequent fast sodium inward current and a trigger beat that then degenerates into fast Table 1 Classification of genetic evidence by the Clinical Genome Resource (ClinGen) for genes previously associated with LQTS Figure 1 Diagnostic criteria for long QT syndrome (LQTS) (the http://heart.bmj.com/ ‘Schwartz- score’). Definite LQTS is defined by an LQTS score ≥3.5 points, Gene Protein Level of evidence intermediate probability of LQTS by an LQTS score of <3.5 and >1 and a AKAP9 A kinase anchor protein 9 Disputed low probability of LQTS by ≤1 point. In the family history rows, the same ANK2 Ankyrin-2 Disputed family member cannot be counted in both categories. CACNA1C Calcium voltage-gated channel α1c Moderate subunit CALM1 Calmodulin-1 Definitive The first two subtypes (LQT1 and 2) are based on functional CALM2 Calmodulin-2 Definitive loss-of - function variants in the potassium channel genes KCNQ1 on October 2, 2021 by guest. Protected copyright. CALM3 Calmodulin-3 Definitive and KCNH2, respectively. These genes respectively encode for CAV3 Caveolin-3 Limited the slow and rapid delayed rectifier current IKs and IKr, and a smaller amplitude of this current leads to prolongation of the KCNE1 Potassium voltage-gated channel Disputed subfamily E regulatory subunit 1 QT interval (figure 4A–D). LQTS type 3 is based on gain-of - KCNE2 Potassium voltage-gated channel Disputed function variants in SCN5A, the gene encoding the fast inward subfamily E regulatory subunit 1 cardiac sodium current (I ). Gain of function relates to an Na KCNH2 Potassium voltage-gated channel Definitive increased amplitude of the late sodium inward current (during subfamily H member 2 the plateau phase), which will also lead to prolongation of the KCNJ2 Potassium voltage-gated channel Limited action potential (figure 4D). subfamily J member 2 The age of onset of arrhythmias is typically younger in LQT1 KCNJ5 Potassium voltage-gated channel Disputed patients and in particular LQT1 males are at risk, whereas most subfamily J member 5 LQT2 and LQT3 patients who become symptomatic experi- KCNQ1 Potassium voltage-gated channel Definitive ence their first symptoms around puberty and here particular subfamily Q member 2 females are at risk (figure 3). Also, the morphology of the SCN4B Sodium voltage-gated channel β Disputed ST- T segments is rather specific for the three subtypes, and the subunit 4 genotype can be accurately predicted with these characteristic SCN5A Sodium channel voltage-gated α Definitive features.12 13 Furthermore, each genotype also has specific trig- subunit 5 gers for arrhythmic events and rather specific electrocardio- SNTA1 Syntrophin α1 Disputed 14–16 graphic features of the onset of the arrhythmias (figure 3). TRDN Triadin Strong The arrhythmias in LQTS (figure 4F) originate from the last *See for more details ref 11. part of the ventricular action potential where severe action LQTs, long QT syndrome . 2 Wilde AAM, et al. Heart 2021;0:1–7. doi:10.1136/heartjnl-2020-318259 Review Heart: first published as 10.1136/heartjnl-2020-318259 on 26 May 2021. Downloaded from http://heart.bmj.com/ Figure 3 Genotype–phenotype relationship for the three most important subtypes, types 1, 2 and 3. See text for further explanation.
Recommended publications
  • Non Commercial Use Only
    Cardiogenetics 2017; volume 7:6304 Sudden death in a young patient with atrial fibrillation Case Report Correspondence: María Angeles Espinosa Castro, Inherited Cardiovascular Disease A 22-year-old man suffered a sudden Program, Cardiology Department, Gregorio María Tamargo, cardiac arrest without previous symptoms Marañón Hospital, Dr. Esquerdo, 46, 28007, María Ángeles Espinosa, while he was at rest, waiting for a subway Madrid, Spain. Víctor Gómez-Carrillo, Miriam Juárez, train. Cardiopulmonary resuscitation was Tel.: +34.91.586.82.90. immediately started using an Automated E-mail: [email protected] Francisco Fernández-Avilés, External Defibrillation that identified the Raquel Yotti Key words: KCNQ1; mutation; channelopa- presence of ventricular fibrillation and thy; sudden cardiac death; atrial fibrillation. Inherited Cardiovascular Disease delivered a shock. Return of spontaneous Program, Cardiology Department, circulation was achieved after three Contributions: MT, acquisition and interpreta- Gregorio Marañón Hospital, Madrid, attempts, being atrial fibrillation (AF) the tion of data for the work, ensuring that ques- Spain patient’s rhythm at this point (Figure 1). tions related to the accuracy or integrity of any He was admitted to our Cardiovascular part of the work is appropriately investigated Intensive Care Unit and therapeutic and resolved; MAE, conception of the work, hypothermia was performed over a period critical revision of the intellectual content, final approval of the version to be published, Abstract of 24 h. After completing hypothermia, ensuring that questions related to the accuracy rewarming, and another 24 h of controlled of any part of the work is appropriately inves- Sudden cardiac death (SCD) in young normothermia the patient awakened with no tigated and resolved; VG-C, acquisition and patients without structural heart disease is residual neurologic damage.
    [Show full text]
  • Towards Mutation-Specific Precision Medicine in Atypical Clinical
    International Journal of Molecular Sciences Review Towards Mutation-Specific Precision Medicine in Atypical Clinical Phenotypes of Inherited Arrhythmia Syndromes Tadashi Nakajima * , Shuntaro Tamura, Masahiko Kurabayashi and Yoshiaki Kaneko Department of Cardiovascular Medicine, Gunma University Graduate School of Medicine, Maebashi 371-8511, Gunma, Japan; [email protected] (S.T.); [email protected] (M.K.); [email protected] (Y.K.) * Correspondence: [email protected]; Tel.: +81-27-220-8145; Fax: +81-27-220-8158 Abstract: Most causal genes for inherited arrhythmia syndromes (IASs) encode cardiac ion channel- related proteins. Genotype-phenotype studies and functional analyses of mutant genes, using heterol- ogous expression systems and animal models, have revealed the pathophysiology of IASs and enabled, in part, the establishment of causal gene-specific precision medicine. Additionally, the utilization of induced pluripotent stem cell (iPSC) technology have provided further insights into the patho- physiology of IASs and novel promising therapeutic strategies, especially in long QT syndrome. It is now known that there are atypical clinical phenotypes of IASs associated with specific mutations that have unique electrophysiological properties, which raises a possibility of mutation-specific precision medicine. In particular, patients with Brugada syndrome harboring an SCN5A R1632C mutation exhibit exercise-induced cardiac events, which may be caused by a marked activity-dependent loss of R1632C-Nav1.5 availability due to a marked delay of recovery from inactivation. This suggests that the use of isoproterenol should be avoided. Conversely, the efficacy of β-blocker needs to be examined. Patients harboring a KCND3 V392I mutation exhibit both cardiac (early repolarization syndrome and Citation: Nakajima, T.; Tamura, S.; paroxysmal atrial fibrillation) and cerebral (epilepsy) phenotypes, which may be associated with a Kurabayashi, M.; Kaneko, Y.
    [Show full text]
  • Long QT Syndrome Testing
    Lab Management Guidelines V2.0.2020 Long QT Syndrome Testing MOL.TS.196.A v2.0.2020 Procedures addressed The inclusion of any procedure code in this table does not imply that the code is under management or requires prior authorization. Refer to the specific Health Plan's procedure code list for management requirements. Procedures addressed by this Procedure codes guideline Long QT Syndrome Sequencing 81413 Multigene Panel Long QT Syndrome Deletion/Duplication 81414 Panel Long QT Syndrome Known Familial 81403 Mutation Analysis ANK2 Sequencing 81479 CASQ2 Sequencing 81405 CAV3 Sequencing 81404 KCNE1 Sequencing 81479 KCNE2 Sequencing 81479 KCNH2 Sequencing 81406 KCNJ2 Sequencing 81403 KCNQ1 Sequencing 81406 RYR2 Sequencing 81408 SCN5A Sequencing 81407 SCN4B Sequencing 81479 AKAP9 Sequencing 81479 SNTA1 Sequencing 81479 KCNJ5 Sequencing 81479 CALM1 Sequencing 81479 CALM2 Sequencing 81479 CACNA1C Sequencing 81479 © 2020 eviCore healthcare. All Rights Reserved. 1 of 7 400 Buckwalter Place Boulevard, Bluffton, SC 29910 (800) 918-8924 www.eviCore.com Lab Management Guidelines V2.0.2020 What is Long QT syndrome Definition Long QT Syndrome (LQTS) is caused by mutations in a number of genes, most of which are related to the functioning of sodium or potassium ion channels in the heart.1 Testing may offer prognostic information in some cases, as specific genes and even specific mutations within those genes may have some correlation to risk for sudden death, effectiveness of beta-blocker therapy, and preventive strategies.1-4 Signs and symptoms of long QT syndrome (LQTS) are variable, but may include a prolonged QT interval on an electrocardiogram, torsades de pointes, syncope, seizures, cardiac arrest, and sudden cardiac death.1,2 Many patients with LQTS can be largely asymptomatic, with cardiac arrest or sudden cardiac death as the first and only symptom.
    [Show full text]
  • Drugs and Life-Threatening Ventricular Arrhythmia Risk: Results from the DARE Study Cohort
    Open Access Research BMJ Open: first published as 10.1136/bmjopen-2017-016627 on 16 October 2017. Downloaded from Drugs and life-threatening ventricular arrhythmia risk: results from the DARE study cohort Abigail L Coughtrie,1,2 Elijah R Behr,3,4 Deborah Layton,1,2 Vanessa Marshall,1 A John Camm,3,4,5 Saad A W Shakir1,2 To cite: Coughtrie AL, Behr ER, ABSTRACT Strengths and limitations of this study Layton D, et al. Drugs and Objectives To establish a unique sample of proarrhythmia life-threatening ventricular cases, determine the characteristics of cases and estimate ► The Drug-induced Arrhythmia Risk Evaluation study arrhythmia risk: results from the the contribution of individual drugs to the incidence of DARE study cohort. BMJ Open has allowed the development of a cohort of cases of proarrhythmia within these cases. 2017;7:e016627. doi:10.1136/ proarrhythmia. Setting Suspected proarrhythmia cases were referred bmjopen-2017-016627 ► These cases have provided crucial safety by cardiologists across England between 2003 and 2011. information, as well as underlying clinical and ► Prepublication history for Information on demography, symptoms, prior medical and genetic data. this paper is available online. drug histories and data from hospital notes were collected. ► Only patients who did not die as a result of the To view these files please visit Participants Two expert cardiologists reviewed data the journal online (http:// dx. doi. proarrhythmia could be included. for 293 referred cases: 130 were included. Inclusion org/ 10. 1136/ bmjopen- 2017- ► Referral of cases by cardiologists alone may have criteria were new onset or exacerbation of pre-existing 016627).
    [Show full text]
  • Atrial Fibrillation (ATRIA) Study
    European Journal of Human Genetics (2014) 22, 297–306 & 2014 Macmillan Publishers Limited All rights reserved 1018-4813/14 www.nature.com/ejhg REVIEW Atrial fibrillation: the role of common and rare genetic variants Morten S Olesen*,1,2,4, Morten W Nielsen1,2,4, Stig Haunsø1,2,3 and Jesper H Svendsen1,2,3 Atrial fibrillation (AF) is the most common cardiac arrhythmia affecting 1–2% of the general population. A number of studies have demonstrated that AF, and in particular lone AF, has a substantial genetic component. Monogenic mutations in lone and familial AF, although rare, have been recognized for many years. Presently, mutations in 25 genes have been associated with AF. However, the complexity of monogenic AF is illustrated by the recent finding that both gain- and loss-of-function mutations in the same gene can cause AF. Genome-wide association studies (GWAS) have indicated that common single-nucleotide polymorphisms (SNPs) have a role in the development of AF. Following the first GWAS discovering the association between PITX2 and AF, several new GWAS reports have identified SNPs associated with susceptibility of AF. To date, nine SNPs have been associated with AF. The exact biological pathways involving these SNPs and the development of AF are now starting to be elucidated. Since the first GWAS, the number of papers concerning the genetic basis of AF has increased drastically and the majority of these papers are for the first time included in a review. In this review, we discuss the genetic basis of AF and the role of both common and rare genetic variants in the susceptibility of developing AF.
    [Show full text]
  • Expanded Genetic Screening Panel for the Ashkenazi Jewish Population B
    Donald and Barbara Zucker School of Medicine Journal Articles Academic Works 2015 Expanded genetic screening panel for the Ashkenazi Jewish population B. Baskovich I. Peter J. H. Cho G. Atzmon L. Clark See next page for additional authors Follow this and additional works at: https://academicworks.medicine.hofstra.edu/articles Part of the Psychiatry Commons Recommended Citation Baskovich B, Peter I, Cho J, Atzmon G, Clark L, Yu J, Lencz T, Pe'er I, Ostrer H, Oddoux C, . Expanded genetic screening panel for the Ashkenazi Jewish population. 2015 Jan 01; 18(5):Article 779 [ p.]. Available from: https://academicworks.medicine.hofstra.edu/ articles/779. Free full text article. This Article is brought to you for free and open access by Donald and Barbara Zucker School of Medicine Academic Works. It has been accepted for inclusion in Journal Articles by an authorized administrator of Donald and Barbara Zucker School of Medicine Academic Works. For more information, please contact [email protected]. Authors B. Baskovich, I. Peter, J. H. Cho, G. Atzmon, L. Clark, J. Yu, T. Lencz, I. Pe'er, H. Ostrer, C. Oddoux, and +7 additional authors This article is available at Donald and Barbara Zucker School of Medicine Academic Works: https://academicworks.medicine.hofstra.edu/articles/779 HHS Public Access Author manuscript Author ManuscriptAuthor Manuscript Author Genet Med Manuscript Author . Author manuscript; Manuscript Author available in PMC 2017 May 01. Published in final edited form as: Genet Med. 2016 May ; 18(5): 522–528. doi:10.1038/gim.2015.123. Expanded Genetic Screening Panel for the Ashkenazi Jewish Population Brett Baskovich, MD1,*, Susan Hiraki, MS, MPH, CGC2,**, Kinnari Upadhyay, MS2,**, Philip Meyer2, Shai Carmi, PhD3, Nir Barzilai, MD2, Ariel Darvasi, PhD4, Laurie Ozelius, PhD5, Inga Peter, PhD5, Judy H.
    [Show full text]
  • Brugada Syndrome
    Brugada Syndrome Begoña Benito, Ramon Brugada, Josep Brugada and Pedro Brugada cular features of the Brugada syndrome, and Since its first description in 1992 as a new clinical entity, the Brugada syndrome has aroused great provides updated information supplied by recent interest among physicians and basic scientists. clinical and basic studies. Two consensus conferences held in 2002 and 2005 helped refine the current accepted definite diag- Diagnostic Criteria and nostic criteria for the syndrome, briefly, the char- General Characteristics acteristic ECG pattern (right bundle branch block and persistent ST segment elevation in right After the initial description of the syndrome, several precordial leads) together with the susceptibility ambiguities appeared in the first years concerning for ventricular fibrillation and sudden death. In the the diagnosis and the specific electrocardiographic last years, clinical and basic research have pro- criteria. Three repolarization patterns were soon vided very valuable knowledge on the genetic identified (Fig 2)14:(a) type-1 electrocardiogram basis, the cellular mechanisms responsible for the typical ECG features and the electrical suscept- (ECG) pattern, the one described in the initial ibility, the clinical particularities and modulators, the report in 1992, in which a coved ST-segment diagnostic value of drug challenge, the risk strati- elevation greater than or equal to 2 mm is followed fication of sudden death (possibly the most con- by a negative T wave, with little or no isoelectric troversial issue) and, finally, the possible separation, this feature being present in more than 1 therapeutic approaches for the disease. Each one right precordial lead (from V1 to V3); (b)type-2 of these points is discussed in this review, which ECG pattern, also characterized by an ST-segment intends to provide updated information supplied by elevation but followed by a positive or biphasic T recent clinical and basic studies.
    [Show full text]
  • Should Genetic Testing Be Recommended for Long QT Syndrome Patients and Their Relatives?
    The Science Journal of the Lander College of Arts and Sciences Volume 11 Number 1 Fall 2017 - 2017 Should Genetic Testing Be Recommended for Long QT Syndrome Patients and Their Relatives? Menachem Braun Touro College Follow this and additional works at: https://touroscholar.touro.edu/sjlcas Part of the Cardiovascular Diseases Commons, and the Medical Genetics Commons Recommended Citation Braun, M. (2017). Should Genetic Testing Be Recommended for Long QT Syndrome Patients and Their Relatives?. The Science Journal of the Lander College of Arts and Sciences, 11(1). Retrieved from https://touroscholar.touro.edu/sjlcas/vol11/iss1/8 This Article is brought to you for free and open access by the Lander College of Arts and Sciences at Touro Scholar. It has been accepted for inclusion in The Science Journal of the Lander College of Arts and Sciences by an authorized editor of Touro Scholar. For more information, please contact [email protected]. Should Genetic Testing be Recommended for Long QT Syndrome Patients and Their Relatives? Menachem Braun Menachem Braun graduated with a BS in Biology in September 2017. Abstract 7KH/RQJ476\QGURPH /476 LVDIDPLOLDOSRWHQWLDOO\IDWDOFDUGLDFDUUK\WKPLD7UDGLWLRQDOO\LWKDVEHHQGLDJQRVHGE\(&* Molecular studies have provided evidence that LQTS can be caused by a range of underlying molecular abnormalities. Genetic research has proven that different forms of LQTS have different genotypic bases. Therefore, it has become possible to diagnose WKHVSHFLÀFW\SHRIGLVHDVHJHQHWLFDOO\7KLVVWXG\H[DPLQHVWKHDGYDQFHPHQWVPDGHLQWKHSDVWWKLUW\\HDUVLQXQGHUVWDQGLQJ /476DQGUHVHDUFKUHJDUGLQJWKHXVHRIJHQHWLFWHVWLQJLQRUGHUWRGHWHUPLQHWKHEHQHÀWVRIJHQHWLFWHVWLQJIRUWKLVGLVHDVH$ survey of original studies which produced the information is presented here, and provides the reader with an understanding of the PHFKDQLFVRIWKHGLVHDVHDQGKRZWKH\GLIIHULQWKHVHYHUDOJHQHWLFYDULDQWV5HVHDUFKVKRZVWKDWWKHEHQHÀWRIJHQHWLFWHVWLQJ must be weighed against the personal implications in may have for a particular patient and his or her family.
    [Show full text]
  • Latest Diagnostic and Treatment Strategies for the Congenital Long QT Syndromes
    Latest Diagnostic and Treatment Strategies for the Congenital Long QT Syndromes Michael J. Ackerman, MD, PhD Windland Smith Rice Cardiovascular Genomics Research Professor Professor of Medicine, Pediatrics, and Pharmacology Director, Long QT Syndrome Clinic and the Mayo Clinic Windland Smith Rice Sudden Death Genomics Laboratory President, Sudden Arrhythmia Death Syndromes (SADS) Foundation Learning Objectives to Disclose: • To RECOGNIZE the “faces” (phenotypes) of the congenital long QT syndromes (LQTS) • To CRITIQUE the various diagnostic modalities used in the evaluation of LQTS and UNDERSTAND their limitations • To ASSESS the currently available treatment options for the various LQT syndromes and EVALUATE their efficacy WINDLAND Smith Rice Sudden Death Genomics Laboratory Conflicts of Interest to Disclose: • Consultant – Boston Scientific, Gilead Sciences, Medtronic, St. Jude Medical, and Transgenomic/FAMILION • Royalties – Transgenomic/FAMILION Congenital Long QT Syndrome Normal QT interval QT QT Prolonged QT 1. Syncope 2. Seizures 3. Sudden death Torsades de pointes Congenital Long QT Syndrome Normal QT interval QT QT ♥ 1957 – first clinical description – JLNS ♥ 1960s – RomanoProlonged-Ward QT syndrome ♥ 1983 – “Schwartz/Moss score”1. Syncope ♥ 1991 – first LQTS chromosome locus 2. Seizures ♥ March 10, 1995 – birth of cardiac 3. Sudden channelopathies death Torsades de pointes Congenital Long QT Syndrome Normal QT interval QT QT Prolonged QT 1. Syncope 2. Seizures 3. Sudden death Torsades de pointes Congenital Long QT Syndrome Normal
    [Show full text]
  • Brugada Syndrome: Clinical Care Amidst Pathophysiological Uncertainty
    Heart, Lung and Circulation (2020) 29, 538–546 REVIEW 1443-9506/19/$36.00 https://doi.org/10.1016/j.hlc.2019.11.016 Brugada Syndrome: Clinical Care Amidst Pathophysiological Uncertainty Julia C. Isbister, MBBS a,b,c, Andrew D. Krahn, MD d, Christopher Semsarian, MBBS, PhD, MPH a,b,c, Raymond W. Sy, MBBS, PhD b,c,* aAgnes Ginges Centre for Molecular Cardiology at Centenary Institute, University of Sydney, Sydney, NSW, Australia bFaculty of Medicine and Health, University of Sydney, Sydney, NSW, Australia cDepartment of Cardiology, Royal Prince Alfred Hospital, Sydney, NSW, Australia dDivision of Cardiology, University of British Columbia, Vancouver, Canada Received 16 August 2019; received in revised form 14 November 2019; accepted 25 November 2019; online published-ahead-of-print 17 December 2019 Brugada syndrome (BrS) is a complex clinical entity with ongoing conjecture regarding its genetic basis, underlying pathophysiology, and clinical management. Within this paradigm of uncertainty, clinicians are faced with the challenge of caring for patients with this uncommon but potentially fatal condition. This article reviews the current understanding of BrS and highlights the “known unknowns” to reinforce the need for flexible clinical practice in parallel with ongoing scientific discovery. Keywords Brugada syndrome Risk stratification Sudden death Arrhythmogenesis Implantable cardioverter- defibrillator Non-device management Introduction more commonly affected than females, and the average age at diagnosis is in the fourth decade [5]. Brugada syndrome (BrS) is an inherited arrhythmogenic heart disease defined by the classic electrocardiographic feature of coved ST-segment elevation in the right precordial leads and an increased risk of sudden death. Although some Pathophysiology of BrS suspicion of an association of right bundle branch block, A schema of our current understanding of the pathophysi- early repolarisation and idiopathic VF had been raised by ology of BrS is summarised in Figure 1.
    [Show full text]
  • Recurrent Syncope in the Andersen Tawil Syndrome E Cardiac Or Neurological?
    indian pacing and electrophysiology journal 15 (2015) 158e161 HOSTED BY Available online at www.sciencedirect.com ScienceDirect journal homepage: www.elsevier.com/locate/IPEJ Recurrent syncope in the Andersen Tawil syndrome e Cardiac or neurological? Michael David Fryer a,*, Gerald Kaye a, Susan Tomlinson b a Department of Cardiology, Princess Alexandra Hospital, University of Queensland, Australia b St Vincent's Clinic, University of Sydney, Australia article info EEG and MRI brain were normal. A further episode of tran- sient loss of consciousness, documented in the hospital re- Article history: cord as ‘consistent with seizure activity’ occurred; cardiac Available online 20 October 2015 monitoring did not reveal an arrhythmia. A clinical diagnosis of epilepsy was made based on the description of the epi- sodes and lack of a symptom rhythm correlation. The patient Keywords: was commenced on sodium valproate, which prevented Andersen-Tawil syndrome further episodes. Bidirectional ventricular tachy- Surface electrocardiograms recorded during the admission cardia documented asymptomatic, frequent polymorphic ectopy Channelopathy Fig. 1. Syncope ' The QTc was marginally prolonged at 465ms (Bazett s for- mula). Echocardiogram showed no evidence of structural heart disease. An outpatient Holter monitor confirmed the background rhythm was sinus, with episodes of non- sustained bidirectional ventricular tachycardia and frequent multimorphological ventricular ectopy with a 25% ectopic burden. Ectopy was suppressed completely during treadmill Case presentation exercise testing. The effect of exercise on the QT interval was not recorded. Metoprolol, verapamil, sotalol and flecainide An 8-year-old female patient was referred to a paediatrician were sequentially tried, but were either ineffective or pro- for assessment of an episode of global muscle weakness after duced intolerable side effects.
    [Show full text]
  • Test Requisition MOLECULAR DIAGNOSTICS LABORATORY
    FOR LAB USE ONLY TEST #____________________________________ Test Requisition DATE REC’D________________________________ MOLECULAR DIAGNOSTICS LABORATORY Phone: (440) 632-1668 TIME REC’D ___________ ______________ DDC CLINIC – CENTER FOR SPECIAL NEEDS CHILDREN Fax: (440) 632 -1697 14567 Madison Rd. www.ddcclinic.org Middlefield, OH 44062 Please complete all fields below. Missing or incomplete information may dela y specimen processing. PATIENT INFORMATION / / Name (Last) (First) (Middle) Date of Birth (MM/DD/YYYY) Address (Street) ( ) - (City) (State) (Zip) (Phone) RACE/ETHNICITY: ☐ African American ☐ Caucasian ☐ Amish ☐ Other GENDER: ☐ Female ☐ Male ☐ Unknown/Not Reported SPECIMEN INFORMATION - SPECIMEN SOURCE: ☐ Peripheral Blood ☐ Cord Blood ☐ DNA ☐ Other / / Please specify Date Collected: (MM/DD/YYYY) INDICATIONS FOR TESTING (Required) ------------- REASONS FOR TEST (family history, clinical symptoms, etc.) AND ICD9 CODES: RELEVANT CLINICAL AND LABORATORY INFORMATION: REFERRING PHYSICIAN, CERTIFIED NURSE MIDWIFE, GENETIC COUNSELOR / Name Title NPI# (Required for insurance billing) Address (Institution, Practice, Organization) (Street) ( ) - ( ) - (City) (State) (Zip) (Phone) (Fax) Name and phone of contact person regarding this sample: REPORT RESULTS TO ADDITIONAL PHYSICIAN, MIDWIFE, GENETIC COUNSELOR (IF APPLICABLE) Name Title Address (Institution, Practice, Organization) (Street) ( ) - ( ) - (City) (State) (Zip) (Phone) (Fax) BILLING INFORMATION (Required) Bill: ☐ Insurance Relationship of Patient to Insurance Holder: ☐ Self ☐ Child
    [Show full text]