PCDHB3 Polyclonal Antibody (A01) Cell-Cell Connections

Total Page：16

File Type：pdf, Size：1020Kb

PCDHB3 polyclonal antibody (A01) cell-cell connections. Unlike the alpha and gamma clusters, the transcripts from these genes are made up Catalog Number: H00056132-A01 of only one large exon, not sharing common 3' exons as expected. These neural cadherin-like cell adhesion Regulatory Status: For research use only (RUO) proteins are integral plasma membrane proteins. Their specific functions are unknown but they most likely play Product Description: Mouse polyclonal antibody raised a critical role in the establishment and function of against a partial recombinant PCDHB3. specific cell-cell neural connections. [provided by RefSeq] Immunogen: PCDHB3 (NP_061760, 284 a.a. ~ 381 a.a) partial recombinant protein with GST tag. Sequence: ASEEIRKTFQLNPITGDMQLVKYLNFEAINSYEVDIEAK DGGGLSGKSTVIVQVVDVNDNPPELTLSSVNSPIPENS GETVLAVFSVSDLDSGDNGRV Host: Mouse Reactivity: Human Applications: ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Storage Buffer: 50 % glycerol Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 56132 Gene Symbol: PCDHB3 Gene Alias: PCDH-BETA3 Gene Summary: This gene is a member of the protocadherin beta gene cluster, one of three related gene clusters tandemly linked on chromosome five. The gene clusters demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The beta cluster contains 16 genes and 3 pseudogenes, each encoding 6 extracellular cadherin domains and a cytoplasmic tail that deviates from others in the cadherin superfamily. The extracellular domains interact in a homophilic manner to specify differential Page 1/1 Powered by TCPDF (www.tcpdf.org).

Copy Link

Recommended publications

Genomic Correlates of Relationship QTL Involved in Fore- Versus Hind Limb Divergence in Mice
Loyola University Chicago Loyola eCommons Biology: Faculty Publications and Other Works Faculty Publications 2013 Genomic Correlates of Relationship QTL Involved in Fore- Versus Hind Limb Divergence in Mice Mihaela Palicev Gunter P. Wagner James P. Noonan Benedikt Hallgrimsson James M. Cheverud Loyola University Chicago, [email protected] Follow this and additional works at: https://ecommons.luc.edu/biology_facpubs Part of the Biology Commons Recommended Citation Palicev, M, GP Wagner, JP Noonan, B Hallgrimsson, and JM Cheverud. "Genomic Correlates of Relationship QTL Involved in Fore- Versus Hind Limb Divergence in Mice." Genome Biology and Evolution 5(10), 2013. This Article is brought to you for free and open access by the Faculty Publications at Loyola eCommons. It has been accepted for inclusion in Biology: Faculty Publications and Other Works by an authorized administrator of Loyola eCommons. For more information, please contact [email protected]. This work is licensed under a Creative Commons Attribution-Noncommercial-No Derivative Works 3.0 License. © Palicev et al., 2013. GBE Genomic Correlates of Relationship QTL Involved in Fore- versus Hind Limb Divergence in Mice Mihaela Pavlicev1,2,*, Gu¨ nter P. Wagner3, James P. Noonan4, Benedikt Hallgrı´msson5,and James M. Cheverud6 1Konrad Lorenz Institute for Evolution and Cognition Research, Altenberg, Austria 2Department of Pediatrics, Cincinnati Children‘s Hospital Medical Center, Cincinnati, Ohio 3Yale Systems Biology Institute and Department of Ecology and Evolutionary Biology, Yale University 4Department of Genetics, Yale University School of Medicine 5Department of Cell Biology and Anatomy, The McCaig Institute for Bone and Joint Health and the Alberta Children’s Hospital Research Institute for Child and Maternal Health, University of Calgary, Calgary, Canada 6Department of Anatomy and Neurobiology, Washington University *Corresponding author: E-mail: [email protected].
[Show full text]
Supplementary Table 1: Adhesion Genes Data Set
Supplementary Table 1: Adhesion genes data set PROBE Entrez Gene ID Celera Gene ID Gene_Symbol Gene_Name 160832 1 hCG201364.3 A1BG alpha-1-B glycoprotein 223658 1 hCG201364.3 A1BG alpha-1-B glycoprotein 212988 102 hCG40040.3 ADAM10 ADAM metallopeptidase domain 10 133411 4185 hCG28232.2 ADAM11 ADAM metallopeptidase domain 11 110695 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 195222 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 165344 8751 hCG20021.3 ADAM15 ADAM metallopeptidase domain 15 (metargidin) 189065 6868 null ADAM17 ADAM metallopeptidase domain 17 (tumor necrosis factor, alpha, converting enzyme) 108119 8728 hCG15398.4 ADAM19 ADAM metallopeptidase domain 19 (meltrin beta) 117763 8748 hCG20675.3 ADAM20 ADAM metallopeptidase domain 20 126448 8747 hCG1785634.2 ADAM21 ADAM metallopeptidase domain 21 208981 8747 hCG1785634.2|hCG2042897 ADAM21 ADAM metallopeptidase domain 21 180903 53616 hCG17212.4 ADAM22 ADAM metallopeptidase domain 22 177272 8745 hCG1811623.1 ADAM23 ADAM metallopeptidase domain 23 102384 10863 hCG1818505.1 ADAM28 ADAM metallopeptidase domain 28 119968 11086 hCG1786734.2 ADAM29 ADAM metallopeptidase domain 29 205542 11085 hCG1997196.1 ADAM30 ADAM metallopeptidase domain 30 148417 80332 hCG39255.4 ADAM33 ADAM metallopeptidase domain 33 140492 8756 hCG1789002.2 ADAM7 ADAM metallopeptidase domain 7 122603 101 hCG1816947.1 ADAM8 ADAM metallopeptidase domain 8 183965 8754 hCG1996391 ADAM9 ADAM metallopeptidase domain 9 (meltrin gamma) 129974 27299 hCG15447.3 ADAMDEC1 ADAM-like,
[Show full text]
LETTER Doi:10.1038/Nature09515
LETTER doi:10.1038/nature09515 Distant metastasis occurs late during the genetic evolution of pancreatic cancer Shinichi Yachida1*, Siaˆn Jones2*, Ivana Bozic3, Tibor Antal3,4, Rebecca Leary2, Baojin Fu1, Mihoko Kamiyama1, Ralph H. Hruban1,5, James R. Eshleman1, Martin A. Nowak3, Victor E. Velculescu2, Kenneth W. Kinzler2, Bert Vogelstein2 & Christine A. Iacobuzio-Donahue1,5,6 Metastasis, the dissemination and growth of neoplastic cells in an were present in the primary pancreatic tumours from which the meta- organ distinct from that in which they originated1,2, is the most stases arose. A small number of these samples of interest were cell lines common cause of death in cancer patients. This is particularly true or xenografts, similar to the index lesions, whereas the majority were for pancreatic cancers, where most patients are diagnosed with fresh-frozen tissues that contained admixed neoplastic, stromal, metastatic disease and few show a sustained response to chemo- inflammatory, endothelial and normal epithelial cells (Fig. 1a). Each therapy or radiation therapy3. Whether the dismal prognosis of tissue sample was therefore microdissected to minimize contaminat- patients with pancreatic cancer compared to patients with other ing non-neoplastic elements before purifying DNA. types of cancer is a result of late diagnosis or early dissemination of Two categories of mutations were identified (Fig. 1b). The first and disease to distant organs is not known. Here we rely on data gen- largest category corresponded to those mutations present in all samples erated by sequencing the genomes of seven pancreatic cancer meta- from a given patient (‘founder’ mutations, mean of 64%, range 48–83% stases to evaluate the clonal relationships among primary and of all mutations per patient; Fig.
[Show full text]
2021.01.13.426573V1.Full.Pdf
bioRxiv preprint doi: https://doi.org/10.1101/2021.01.13.426573; this version posted January 13, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. EVOLUTIONARY PERSPECTIVE AND EXPRESSION ANALYSIS OF INTRONLESS GENES HIGHLIGHT THE CONSERVATION ON THEIR REGULATORY ROLE Katia Aviña-Padilla1,2, José Antonio Ramírez-Rafael3, Gabriel Emilio Herrera-Oropeza1,4, Vijaykumar Muley1, Dulce I. Valdivia2, Erik Díaz-Valenzuela2, Andrés García-García3, Alfredo Varela-Echavarría1* and Maribel Hernández-Rosales2*. 1Instituto de Neurobiología, Universidad Nacional Autónoma de México, Querétaro, México. 2Centro de Investigación y de Estudios Avanzados del IPN, Unidad Irapuato, Guanajuato, México. 3Centro de Física Aplicada y Tecnología Avanzada, Universidad Nacional Autónoma de México, Querétaro, México. 4Centre for Developmental Neurobiology, Institute of Psychiatry, Psychology, and Neuroscience, King's College London, London, United Kingdom. * Correspondence: Maribel Hernández-Rosales [email protected] Alfredo Varela-Echavarría [email protected] Keywords: intronless genes1, exon-intron architecture2, embryonic telencephalon3, protocadherins4, histones5, transcription factors6, evolutionary histories7, microproteins8. bioRxiv preprint doi: https://doi.org/10.1101/2021.01.13.426573; this version posted January 13, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International licenseIntronless. genes regulatory role Abstract Eukaryotic gene structure is a combination of exons generally interrupted by intragenic non-coding DNA regions termed introns removed by RNA splicing to generate the mature mRNA.
[Show full text]
Human Copy Number Variants Are Enriched in Regions of Low-Mappability
bioRxiv preprint doi: https://doi.org/10.1101/034165; this version posted May 9, 2016. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Human copy number variants are enriched in regions of low-mappability Jean Monlong1,2, Patrick Cossette3, Caroline Meloche3, Guy Rouleau4, Simon L. Girard1,5, and Guillaume Bourque1,2,6 1Department of Human Genetics, McGill University, Montréal,H3A 1B1, Canada 2McGill University and GénomeQuébec Innovation Center, Montréal,H3A 1A4, Canada 3Centre de Recherche du Centre Hospitalier de l'Universitéde Montréal,Montreal, H2X 0A9, Québec, Canada. 4Montreal Neurological Institute, McGill University, Montréal,H3A 2B4, Québec, Canada. 5Département des sciences fondamentales, Universitédu Québec àChicoutimi, Chicoutimi, G7H 2B1, Canada 6Correspondence: [email protected] April 27, 2016 Abstract Germline copy number variants (CNVs) are known to affect a large portion of the human genome and have been implicated in many diseases. Although whole-genome sequencing can help identify CNVs, existing analytical methods suffer from limited sensitivity and specificity. Here we show that this is in large part due to the non-uniformity of read coverage, even after intra-sample normalization, and that this is exacerbated in regions of low-mappability. To improve on this, we propose PopSV, an analytical method that uses multiple samples to control for technical variation and enables the robust detection of CNVs.
[Show full text]
Peripheral Nerve Single-Cell Analysis Identifies Mesenchymal Ligands That Promote Axonal Growth
Research Article: New Research Development Peripheral Nerve Single-Cell Analysis Identifies Mesenchymal Ligands that Promote Axonal Growth Jeremy S. Toma,1 Konstantina Karamboulas,1,ª Matthew J. Carr,1,2,ª Adelaida Kolaj,1,3 Scott A. Yuzwa,1 Neemat Mahmud,1,3 Mekayla A. Storer,1 David R. Kaplan,1,2,4 and Freda D. Miller1,2,3,4 https://doi.org/10.1523/ENEURO.0066-20.2020 1Program in Neurosciences and Mental Health, Hospital for Sick Children, 555 University Avenue, Toronto, Ontario M5G 1X8, Canada, 2Institute of Medical Sciences University of Toronto, Toronto, Ontario M5G 1A8, Canada, 3Department of Physiology, University of Toronto, Toronto, Ontario M5G 1A8, Canada, and 4Department of Molecular Genetics, University of Toronto, Toronto, Ontario M5G 1A8, Canada Abstract Peripheral nerves provide a supportive growth environment for developing and regenerating axons and are es- sential for maintenance and repair of many non-neural tissues. This capacity has largely been ascribed to paracrine factors secreted by nerve-resident Schwann cells. Here, we used single-cell transcriptional profiling to identify ligands made by different injured rodent nerve cell types and have combined this with cell-surface mass spectrometry to computationally model potential paracrine interactions with peripheral neurons. These analyses show that peripheral nerves make many ligands predicted to act on peripheral and CNS neurons, in- cluding known and previously uncharacterized ligands. While Schwann cells are an important ligand source within injured nerves, more than half of the predicted ligands are made by nerve-resident mesenchymal cells, including the endoneurial cells most closely associated with peripheral axons. At least three of these mesen- chymal ligands, ANGPT1, CCL11, and VEGFC, promote growth when locally applied on sympathetic axons.
[Show full text]
Thousands of Cpgs Show DNA Methylation Differences in ACPA-Positive Individuals
G C A T T A C G G C A T genes Article Thousands of CpGs Show DNA Methylation Differences in ACPA-Positive Individuals Yixiao Zeng 1,2, Kaiqiong Zhao 2,3, Kathleen Oros Klein 2, Xiaojian Shao 4, Marvin J. Fritzler 5, Marie Hudson 2,6,7, Inés Colmegna 6,8, Tomi Pastinen 9,10, Sasha Bernatsky 6,8 and Celia M. T. Greenwood 1,2,3,9,11,* 1 PhD Program in Quantitative Life Sciences, Interfaculty Studies, McGill University, Montréal, QC H3A 1E3, Canada; [email protected] 2 Lady Davis Institute for Medical Research, Jewish General Hospital, Montréal, QC H3T 1E2, Canada; [email protected] (K.Z.); [email protected] (K.O.K.); [email protected] (M.H.) 3 Department of Epidemiology, Biostatistics and Occupational Health, McGill University, Montréal, QC H3A 1A2, Canada 4 Digital Technologies Research Centre, National Research Council Canada, Ottawa, ON K1A 0R6, Canada; [email protected] 5 Cumming School of Medicine, University of Calgary, Calgary, AB T2N 1N4, Canada; [email protected] 6 Department of Medicine, McGill University, Montréal, QC H4A 3J1, Canada; [email protected] (I.C.); [email protected] (S.B.) 7 Division of Rheumatology, Jewish General Hospital, Montréal, QC H3T 1E2, Canada 8 Division of Rheumatology, McGill University, Montréal, QC H3G 1A4, Canada 9 Department of Human Genetics, McGill University, Montréal, QC H3A 0C7, Canada; [email protected] 10 Center for Pediatric Genomic Medicine, Children’s Mercy, Kansas City, MO 64108, USA 11 Gerald Bronfman Department of Oncology, McGill University, Montréal, QC H4A 3T2, Canada * Correspondence: [email protected] Citation: Zeng, Y.; Zhao, K.; Oros Abstract: High levels of anti-citrullinated protein antibodies (ACPA) are often observed prior to Klein, K.; Shao, X.; Fritzler, M.J.; Hudson, M.; Colmegna, I.; Pastinen, a diagnosis of rheumatoid arthritis (RA).
[Show full text]
Inherited Hearing Loss: from Gene Variants to Mechanisms of Disease
UNIVERSITÀ DEGLI STUDI DI MILANO Scuola di Dottorato in Scienze Biologiche e Molecolari XXVI Ciclo Inherited hearing loss: from gene variants to mechanisms of disease Michela Robusto PhD Thesis Scientific tutor: Dott.ssa Giulia Soldà Academic year: 2012/2013 SSD: BIO/13 Thesis performed at the Department of Medical Biotechnology and Translational Medicine Index Abbreviations And Notes ............................................................................................................................ i Part I ............................................................................................................................................... I Abstract ............................................................................................................................................ 1 1. State of the Art ................................................................................................................ 3 1.1 The auditory system .................................................................................................................... 4 1.2 Sensorineural hearing loss .......................................................................................................... 6 1.2.1 Genetic of hearing loss ....................................................................................................... 8 1.2.2 Hearing loss treatment and prevention .......................................................................... 10 1.3 MiRNA involvement in NSHL: the miR-183 family ..........................................................
[Show full text]
Remote Memory and Cortical Synaptic Plasticity Require Neuronal CCCTC-Binding Factor (CTCF)
5042 • The Journal of Neuroscience, May 30, 2018 • 38(22):5042–5052 Cellular/Molecular Remote Memory and Cortical Synaptic Plasticity Require Neuronal CCCTC-Binding Factor (CTCF) X Somi Kim,1* Nam-Kyung Yu,1* Kyu-Won Shim,2 XJi-il Kim,1 X Hyopil Kim,1 Dae Hee Han,1 XJa Eun Choi,1 X Seung-Woo Lee,1 X Dong Il Choi,1 Myung Won Kim,1 Dong-Sung Lee,3 Kyungmin Lee,4 Niels Galjart,5 X Yong-Seok Lee,6 XJae-Hyung Lee,7 and XBong-Kiun Kaang1 1Department of Biological Sciences, College of Natural Sciences, Seoul National University, Seoul 08826, South Korea, 2Interdisciplinary Program in Bioinformatics, Seoul National University, Seoul 08826, South Korea, 3Salk Institute for Biological Studies, La Jolla, California 92130, 4Department of Anatomy, Graduate School of Medicine, Kyungpook National University, Daegu 700-422, Korea, 5Department of Cell Biology and Genetics, 3000 CA Rotterdam, The Netherlands, 6Department of Physiology, Seoul National University College of Medicine, Seoul 03080, South Korea, and 7Department of Life and Nanopharmaceutical Sciences, Department of Maxillofacial Biomedical Engineering, School of Dentistry, Kyung Hee University, Seoul 02447, South Korea The molecular mechanism of long-term memory has been extensively studied in the context of the hippocampus-dependent recent memory examined within several days. However, months-old remote memory maintained in the cortex for long-term has not been investigated much at the molecular level yet. Various epigenetic mechanisms are known to be important for long-term memory, but how the 3D chromatin architecture and its regulator molecules contribute to neuronal plasticity and systems consolidation is still largely unknown.
[Show full text]
Name Aliases Binding Partner Physiology / Oncology References
Name Aliases Binding partner Physiology / Oncology References AJAP1 Adherens junction associated protein 1, ? PHY : Expressed in uterus and pancreas. [1] http://www.uniprot.org/uniprot/Q9UKB5. [2] SHREW1 Plays a role in cell adhesion and migration. McDonald JM, Cancer Biol Ther 2006, 5:300-4 Forms a complex with CDH1 and beta-catenin at adherens junctions [1] ONC : Frequently deleted in oligodendrogliomas, functions to inhibit cell adhesion and migration [2] ALCAM Activated leukocyte cell adhesion CD6 PHY : Adhesion of activated leukocytes and [1] Ofori-Acquah SF, Transl Res 2008, 151:122- molecule, CD166, MEMD (melanoma neurons 8. [2] van Kilsdonk JW, Cancer Res 2008, metastasis clone D) 68:3671-9 ONC : Expressed by different tumor types including melanoma; mediates cancer/ melanoma invasiveness [1,2] AMICA1 Adhesion molecule interacting with CXADR PHY : Expression is restricted to the [1] http://www.uniprot.org/uniprot/Q86YT9. [2] CXADR antigen 1, JAML (junctional hematopoietic tissues with the exception of Moog-Lutz C, Blood 2003, 102:3371-8 adhesion molecule-like) liver. May function in transmigration of leukocytes through epithelial and endothelial tissues. Mediates adhesive interactions with CXADR, a protein of the junctional complex of epithelial cells [1] ONC : Enhances myeloid leukemia cell adhesion to endothelial cells [2] AMIGO1 Amphoterin-induced gene and open AMIGO PHY : May be involved in fasciculation as well [1] http://www.uniprot.org/uniprot/Q86WK6 reading frame 1, Alivin-2 as myelination of developing neural axons. May have a role in regeneration as well as neural plasticity in the adult nervous system. May mediate homophilic as well as heterophilic cell-cell interaction and contribute to signal transduction through its intracellular domain [1] ONC : - AMIGO2 Amphoterin-induced gene and open AMIGO PHY : Highest levels in breast, ovary, cervix, [1] http://www.uniprot.org/uniprot/Q86SJ2.
[Show full text]
Peripheral Nerve Single Cell Analysis Identifies Mesenchymal Ligands That Promote Axonal Growth
Research Article: New Research | Development Peripheral Nerve Single Cell Analysis Identifies Mesenchymal Ligands that Promote Axonal Growth https://doi.org/10.1523/ENEURO.0066-20.2020 Cite as: eNeuro 2020; 10.1523/ENEURO.0066-20.2020 Received: 24 February 2020 Revised: 20 April 2020 Accepted: 23 April 2020 This Early Release article has been peer-reviewed and accepted, but has not been through the composition and copyediting processes. The final version may differ slightly in style or formatting and will contain links to any extended data. Alerts: Sign up at www.eneuro.org/alerts to receive customized email alerts when the fully formatted version of this article is published. Copyright © 2020 Toma et al. This is an open-access article distributed under the terms of the Creative Commons Attribution 4.0 International license, which permits unrestricted use, distribution and reproduction in any medium provided that the original work is properly attributed. 1 Peripheral Nerve Single Cell Analysis Identifies Mesenchymal Ligands that Promote 2 Axonal Growth 3 4 Jeremy S. Toma1, Konstantina Karamboulas1*, Matthew J. Carr 1,2*, Adelaida Kolaj1,3, Scott A. 5 Yuzwa1, Neemat Mahmud 1,3, Mekayla A. Storer1, David R. Kaplan1,2,4 and Freda D. Miller1-4 6 7 Program in Neurosciences and Mental Health1, Hospital for Sick Children, Toronto, Canada 8 M5G 1L7, Institute of Medical Sciences2, Departments of Physiology3 and Molecular Genetics4, 9 University of Toronto, Toronto, Canada M5G 1A8. 10 11 *These authors contributed equally. 12 13 Abbreviated Title: scRNA-seq identifies nerve ligands 14 Author Contributions: JST, DRK and FDM designed research; JST, MJC, AK, and NM 15 performed research; JST, KK, SAY, NM, MAS and FDM analyzed data; and JST, DRK and 16 FDM wrote the paper.
[Show full text]
Activation of the Endogenous Renin-Angiotensin- Aldosterone System Or Aldosterone Administration Increases Urinary Exosomal Sodium Channel Excretion
CLINICAL RESEARCH www.jasn.org Activation of the Endogenous Renin-Angiotensin- Aldosterone System or Aldosterone Administration Increases Urinary Exosomal Sodium Channel Excretion † † Ying Qi,* Xiaojing Wang, Kristie L. Rose,* W. Hayes MacDonald,* Bing Zhang, ‡ | Kevin L. Schey,* and James M. Luther § Departments of *Biochemistry, †Bioinformatics, ‡Division of Clinical Pharmacology, Department of Medicine, §Division of Nephrology, Department of Medicine, and |Department of Pharmacology, Vanderbilt University School of Medicine, Nashville, Tennessee ABSTRACT Urinary exosomes secreted by multiple cell types in the kidney may participate in intercellular signaling and provide an enriched source of kidney-specific proteins for biomarker discovery. Factors that alter the exosomal protein content remain unknown. To determine whether endogenous and exogenous hormones modify urinary exosomal protein content, we analyzed samples from 14 mildly hypertensive patients in a crossover study during a high-sodium (HS, 160 mmol/d) diet and low-sodium (LS, 20 mmol/d) diet to activate the endogenous renin-angiotensin-aldosterone system. We further analyzed selected exosomal protein content in a separate cohort of healthy persons receiving intravenous aldosterone (0.7 mg/kg per hour for 10 hours) versus vehicle infusion. The LS diet increased plasma renin activity and aldosterone concentration, whereas aldosterone infusion increased only aldosterone concentration. Protein analysis of paired urine exosome samples by liquid chromatography-tandem mass spectrometry–based multidimen- sional protein identification technology detected 2775 unique proteins, of which 316 exhibited signifi- cantly altered abundance during LS diet. Sodium chloride cotransporter (NCC) and a-andg-epithelial sodium channel (ENaC) subunits from the discovery set were verified using targeted multiple reaction monitoring mass spectrometry quantified with isotope-labeled peptide standards.
[Show full text]