PCDHB3 polyclonal antibody (A01) cell-cell connections. Unlike the alpha and gamma clusters, the transcripts from these genes are made up Catalog Number: H00056132-A01 of only one large exon, not sharing common 3' exons as expected. These neural cadherin-like cell adhesion Regulatory Status: For research use only (RUO) proteins are integral plasma membrane proteins. Their specific functions are unknown but they most likely play Product Description: Mouse polyclonal antibody raised a critical role in the establishment and function of against a partial recombinant PCDHB3. specific cell-cell neural connections. [provided by RefSeq] Immunogen: PCDHB3 (NP_061760, 284 a.a. ~ 381 a.a) partial recombinant protein with GST tag. Sequence: ASEEIRKTFQLNPITGDMQLVKYLNFEAINSYEVDIEAK DGGGLSGKSTVIVQVVDVNDNPPELTLSSVNSPIPENS GETVLAVFSVSDLDSGDNGRV Host: Mouse Reactivity: Human Applications: ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Storage Buffer: 50 % glycerol Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 56132 Gene Symbol: PCDHB3 Gene Alias: PCDH-BETA3 Gene Summary: This gene is a member of the protocadherin beta gene cluster, one of three related gene clusters tandemly linked on chromosome five. The gene clusters demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The beta cluster contains 16 genes and 3 pseudogenes, each encoding 6 extracellular cadherin domains and a cytoplasmic tail that deviates from others in the cadherin superfamily. The extracellular domains interact in a homophilic manner to specify differential Page 1/1 Powered by TCPDF (www.tcpdf.org).