DOCSLIB.ORG

C12) United States Patent (IO) Patent No.: US 10,011,854 B2 San Et Al

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
C12) United States Patent (IO) Patent No.: US 10,011,854 B2 San Et Al I 1111111111111111 1111111111 11111 1111111111 11111 1111111111111111 IIII IIII IIII US010011854B2 c12) United States Patent (IO) Patent No.: US 10,011,854 B2 San et al. (45) Date of Patent: Jul. 3, 2018 (54) FATTY ACID PRODUCTIVITY WO W02012052468 4/2012 WO WO 2012-087963 * 6/2012 (71) Applicant: WILLIAM MARSH RICE WO WO 2012-109221 * 8/2012 WO W02013059218 4/2013 UNIVERSITY, Houston, TX (US) WO W02013096665 6/2013 (72) Inventors: Ka-Yiu San, Houston, TX (US); Wei OTHER PUBLICATIONS Li, Houston, TX (US) Whisstock et al. Quaterly Reviews of Biophysics, 2003, "Prediction (73) Assignee: William Marsh Rice University, of protein function from protein sequence and structure", 36(3): Houston, TX (US) 307-340.* Witkowski et al. Conversion of a beta-ketoacyl synthase to a ( *) Notice: Subject to any disclaimer, the term ofthis malonyl decarboxylase by replacement of the active-site cysteine patent is extended or adjusted under 35 with glutamine, Biochemistry. Sep. 7, 1999;38(36)11643-50.* U.S.C. 154(b) by O days. Kisselev L., Polypeptide release factors in prokaryotes and eukaryotes: same function, different structure. Structure, 2002, vol. 10: 8-9.* (21) Appl. No.: 15/095,158 Gurvitz Aner, The essential mycobacterial genes, fabG 1 and fabG4, encode 3-oxoacyl-thioester reductases that are functional in yeast (22) Filed: Apr. 11, 2016 mitochondrial fatty acid synthase type 2, Mo! Genet Genomics (2009), 282: 407-416.* (65) Prior Publication Data Bergler H, et a., Protein EnvM is the NADH-dependent enoyl-ACP reductase (Fahl) of Escherichia coli, J Biol Chem. 269(8):5493-6 US 2016/0215309 Al Jul. 28, 2016 (1994). Bokinsky G. et al., Synthesis of three advanced biofuels from ionic Related U.S. Application Data liquid-pretreated switchgrass using engineered Escherichia coli, PNAS, 108(50): 19949-19954 (2011). (63) Continuation-in-part of application No. Caughey I, Kekwick RG, The characteristics of some components PCT/US2014/059319, filed on Oct. 6, 2014. of the fatty acid synthetase system in the plastids fom the mesocarp ofavocado (Persea americana) fruit, Eur J Biochem. 123(3):553-61 (60) Provisional application No. 61/889,166, filed on Oct. (1982). 10, 2013. Dutta D, et al., Crystal structure of FabG4 from Mycobacterium tuberculosis reveals the importance of C-terminal residues in (51) Int. Cl. ketoreductase activity, J Struct Biol. 174(1):147-55 (2011). C12N 1120 (2006.01) Fuhrer T, Sauer U. Different biochemical mechanisms ensure net­ C12P 7164 (2006.01) work-wide balancing of reducing equivalents in microbial metabo­ lism, J Bacteriol. 191(7):2112-21 (2009). C12P 7162 (2006.01) Jing et al., Phylogenetic and experimental characterization of an C12N 9/00 (2006.01) acyl-ACP thioesterase family reveals significant diversity in enzy­ C12N 9102 (2006.01) matic specificity and activity, BMC Biochemistry 2011, 12:44. C07H 21104 (2006.01) Martinez I, et al., Replacing Escherichia coli NAO-dependent C12N 9/04 (2006.01) glyceraldehyde 3-phosphate dehydrogenase (GAPDH) with a NADP-dependent enzyme from Clostridium acetobutylicum facili­ C12N 9/16 (2006.01) tates NADPH dependent pathways, Metab Eng. 10(6):352-9 (2008). (52) U.S. Cl. Murarka A., et al., Fermentative Utilization of Glycerol by CPC C12P 716409 (2013.01); C12N 9/0006 Escherichia coli and Its Implications for the Production of Fuels and (2013.01); C12N 9/16 (2013.01); C12Y Chemicals, Appl Environ Microbiol. Feb. 2008; 74(4): 1124-1135. 1011011 (2013.01); C12Y 101/0133 (2015.07); Radakovits, R., Eduafo, P.M. and Posewitz, M.C. Genetic engineer­ ing of fatty acid chain length in Phaeodactylum tricornutum. Metab. C12Y 301/02014 (2013.01); Cl2Y 101/01 Engin., 13, 89-95 (2011). (2013.01) (Continued) ( 58) Field of Classification Search None Primary Examiner - Iqbal H Chowdhury See application file for complete search history. (74) Attorney, Agent, or Firm - Boulware & Valoir (56) References Cited U.S. PATENT DOCUMENTS (57) ABSTRACT The present disclosure relates to an engineered microbe Al* 2013/0040340 2/2013 Dauner Cl2P 7/6436 capable of improved productivity of fatty acid or fatty acid 435/42 2014/0004580 Al* 1/2014 Roberts . Cl2N 9/0008 derivative. An NAD+-dependent 3-oxoacyl-ACP reductase 435/134 or NAD+-dependent 3-oxoacyl-CoA reductase replaces or 2014/0093921 Al 4/2014 San et al. supplements the native NADP+-dependent 3-oxoacyl-ACP 2014/0193867 Al 7/2014 San et al. 2014/0212935 Al 7/2014 San et al. reductase so as to utilize the higher availability of NAD+ rather than NADP+ in the cell. Higher production, yield and FOREIGN PATENT DOCUMENTS titer of fatty acids are therefore obtained. Such microbes can be combined with other mutations to further improve yield WO W02010142522 12/2010 WO W02011064183 6/2011 of fatty acids or fatty acid derivatives. WO WO 2011-116279 * 9/2011 WO W02011116279 9/2011 7 Claims, 17 Drawing Sheets US 10,011,854 B2 Page 2 (56) References Cited OTHER PUBLICATIONS Ruffing, A.M. & Jones, H.D.T. Physiological effects of free fatty acid production in genetically engineered Synechococcus elongatus PCC 7942. Biotechnology and Bioengineering, 2012; 109 (9): 2190. Sanchez AM, et al., Effect of overexpression of a soluble pyridine nucleotide transhydrogenase (UdhA) on the production of poly(3- hydroxybutyrate) in Escherichia coli, Biotechnol Prog. 22(2):420-5 (2006). Wang Y, at al, Improvement of NADPH bioavailability in Escherichia coli by replacing NAD+-dependent glyceraldehyde-3- phosphate dehydrogenase GapA with NADP +-dependent GapB from Bacillus subtilis and addition ofNAD kinase, J Ind Microbiol Biotechnol. 2013. PMID: 24048943. Zhang X, Li M, Agrawal A, San KY, Efficient free fatty acid production in Escherichia coli using plant acyl-ACP thioesterases, Metab Eng. 13(6):713-22 (2011). * cited by examiner U.S. Patent Jul. 3, 2018 Sheet 1 of 17 US 10,011,854 B2 FIGURE IA Glucose 1 PEP 1 Pyruvate ---.. Acetate ! _/ H•, HCO:;, ATP ADP, p+ Acety! CoA--------__:::,,._,-,::;c/ '--- / ___ .. Malony!-CoA Ace Acy!-CoA ! p ACP-SH "}- - bD r AC -SH Fatty --------. Fab ,..a '---.. Co-A-SH ..,, OAA ~ acids Acy!-ACP ./ --......, thioesterase Ma!onyl-ACP Ma!ate ! Citrate NAD(P) Acyl-ACP ~ FumarateI \ [:] !socitrate NAD 'P)Hr-noyl-ACP l reductase CO + ACP beta-ketoacy!-AC 2 \ J synthase 1/U Succinate o.-ketoglutara!e Enoy!-ACP 3-Ketoacyl-ACP "'Succiny!-CoA / droxyacyl-ACP 7( NADPH and/or H20 dralase 3-oxoacyl-ACP NADH reductase -- 3 D Hyd y! ACP NADP+ and/or - - roxyac - NAD• Fatty acid elongation cycle U.S. Patent Jul. 3, 2018 Sheet 2 of 17 US 10,011,854 B2 FIGURE 1B 0 0 II 11 -o-C-CH2-C-S-CoA 0 II R-C-S-ACP FabD l 0 0 U II FabB -o-C-CH2-C-S-ACP H++ NADH FabF 0 FabH II CHrC-S-CoA 0 0 0 II II II R-CH=CH-C-S-ACP R-C-CH2-C-S-ACP 0 0 11 II FabA CHs-C-CHrC-S-ACP FabZ OH 0 I II R-CH-CHrC-S-ACP NADP+ U.S. Patent Jul. 3, 2018 Sheet 3 of 17 US 10,011,854 B2 FGUREIC Descriptio Step Enzyme Reaction n Activates acetyl CoA Acetyl ~) 0 for reaction (a) CoA:ACP with transacylase G.}·i;'JL.•. ::-1-0:iA (:cH,/L.. ,S-ACP malonyl­ ACP Activates malonyl Malonyl CoA for (b) CoA:ACP reaction transacylase with acetyl­ ACP Reacts priming 3-ketoacyl­ ,i acetyl-ACP ...... _......... : (c) ACP .. with chain­ synthetase {C} extending malonyl­ ACP. NADPH+H;J) Reduces the carbon 3-ketoacyl­ \ ,-,,="' 3 ketone (d) ACP . \-~..,:::'.":.:: ........ toa reductase hydroxyl group 3- H i'' Hydroxyacyl Removes (e) ACP Cl·(;'°L::,1)CS~ACP water dehydrase H NADPH + H © H 0 Enoyl-ACP (f} reductase 01{1.:y)t.. S·"ACP H U.S. Patent Jul. 3, 2018 Sheet 4 of 17 US 10,011,854 B2 trr;. prom11t~r Ras RBS FlGURE2 Abbreviations: RBS, ribosomal binding site; rcTE, acyl-ACP thioesterase from R. communis; MtGl, a NAD"'-dependent 3-oxoacyl-ACP reductase from lvf. tuberculosis; lacl, regulator gene of trc promoter system; AmpR, ampicillin resistant gene; T 1 tem1inator and T2 tenninator, transcriptional terminator of rrnB; pBR322 origin, origin of replication. U.S. Patent Jul. 3, 2018 Sheet 5 of 17 US 10,011,854 B2 /tt:. µr~mt~ttir RSS pXZ18G2 RES Amp,R 12 terminatar FIGURE 3A Abbreviations: RBS, ribosomal binding site; rcTE, acyl-ACP thioesterase from R. communis; MtG2, a NAD+-dependent 3-oxoacyl-ACP reductase from M. tuberculosis with an omission of the first 16 amino acids; lacl, regulator gene of trc promoter system; AmpR, ampicillin resistant gene; Tl terminator and T2 tem1inator, transcriptional terminator of rrnB; pBR322 origin, origin of replication. U.S. Patent Jul. 3, 2018 Sheet 6 of 17 US 10,011,854 B2 trc promoter l / RBS / /" } / t ···-··········"""-.. ,._ 'l '· t'fr' ~tl>a l ( :s. 5 3.3) pXZ18DG2 kt==- MttabG2 Amp~:~~ "~' t2 terminatnr_ .~~:com {3c17:5) _:j'J .··.·_ir:~:,.,.,.,.... .····:·:·:·:»?''*'''':~;Z@fW" . T1 te:rminator- · / . .,\. / \ Hin d1H {4-5 64}° mtfab-G2 FIGURE 3B U.S. Patent Jul. 3, 2018 Sheet 7 of 17 US 10,011,854 B2 FIGURE 4 SEQ ID NO: 1 (Ricinus communis palrnitoyl-acyl carrier protein thioestcrasc (rcTE) from XM - 0025l5518fXP- 002515564 MVATAAAATSSFFPVPSQSADANFDKAPASLGGIKLKSTSCSRG LQVKANAQAPPKINGSSVGFTTSVETVKNDGDMPLPPPPRTFINQLPDWSMLLAAITT IFLAAEKQWMMLDWKPRRPDMLIDPFGIGRIVQDGLIFRQNFSIRSYEIGADRTASIE TLMNHLQETALNHVKTAGLLGDGFGSTPEMSKRNLIWVVTRMQVLVDRYPTWGDVVQV DTWVSKSGKNGMRRDWCVRDSRTGETLTRASSVWVMMNKLTRRLSKIPEEVRGEIEPY FLNSDPIVDEDSRKLPKLDDSNADYVRKGLTPRWSDLDINQHVNNVKYIGWILESAPL PILESHELSAITLEYRRECGRDSVLQSLTAVSGNGIGNLGNAGDIECQHLLRLEDGAE IVRGRTEWRPKYSSNFGIMGQIPVESA FIGURE 5 SEQ ID NO: 2 3-oxoacyl-ACP rcductasc FabG [EC:1.1.1.100] from Mycobactcrium tuberculosis MAPKRSSDLFSQVVNSGPGSFLARQLGVPQPETLRRYRAGEPPLTGSLLIGGAGRVVEPL RAALEKDYDLVGNNLGGRWADSFGGLVFDATGITEPAGLKGLHEFFTPVLRNLGRCGRVV VVGGTPEAAASTNERIAQRALEGFTRSLGKELRRGATTALVYLSPDAKPAATGLESTMRF
Load more

Recommended publications
  • Feedstock List (As of 3/2018)
    Feedstock List (as of 3/2018) FOG: Fats / Oils / Greases Wastes / Oil Seeds Algae / Aquatic Species Industrial Aloe (Aloe vera) Meadowfoam (Limnanthes alba) Brown grease Cyanobacteria Babassu (Attalea speciosa) Mustard (Sinapis alba) Crude glycerine Halophytes (e.g., Salicornia bigelovii) *Camelina (Camelina sativa)* Nuts Fish oil Lemna (Lemna spp.) *Canola, winter (Brassica napus[occasionally rapa Olive (Olea europaea) Industrial effluent (palm) Macroalgae or campestris])* *Carinata (Brassica carinata)* Palm (Elaeis guineensis) Shrimp oil (Caridea) Mallow (Malva spp.) Castor (Ricinus communis) Peanut, Cull (Arachis hypogaea) Tall oil pitch Microalgae Citrus (Citron spp.) Pennycress (Thlaspi arvense) Tallow / Lard Spirodela (Spirodela polyrhiza) Coconut (Cocos nucifera) Pongamia (Millettia pinnata) White grease Wolffia (Wolffia arrhiza) Corn, inedible (Zea mays) Poppy (Papaver rhoeas) Waste vegetable oil Cottonseed (Gossypium) *Rapeseed (Brassica napus)* Yellow grease Croton megalocarpus Oryza sativa Croton ( ) Rice Bran ( ) Cuphea (Cuphea viscossisima) Safflower (Carthamus tinctorius) Flax / Linseed (Linum usitatissimum) Sesame (Sesamum indicum) Gourds / Melons (Cucumis melo) Soybean (Glycine max) Grapeseed (Vitis vinifera) Sunflower (Helianthus annuus) Hemp seeds (Cannabis sativa) Tallow tree (Triadica sebifera) Jojoba (Simmondsia chinensis) Tobacco (Nicotiana tabacum) Jatropha (Jatropha curcas) Calophyllum inophyllum Kamani ( ) Lesquerella (Lesquerella fenderi) Cellulose Woody Grasses Residues Other Types: Arundo (Arundo donax) Bagasse
    [Show full text]
  • Phylogeny and Systematics of Lemnaceae, the Duckweed Family
    Systematic Botany (2002), 27(2): pp. 221±240 q Copyright 2002 by the American Society of Plant Taxonomists Phylogeny and Systematics of Lemnaceae, the Duckweed Family DONALD H. LES,1 DANIEL J. CRAWFORD,2,3 ELIAS LANDOLT,4 JOHN D. GABEL,1 and REBECCA T. K IMBALL2 1Department of Ecology and Evolutionary Biology, University of Connecticut, Storrs, Connecticut 06269-3043; 2Department of Evolution, Ecology, and Organismal Biology, The Ohio State University, Columbus, Ohio 43210; 3Present address: Department of Ecology and Evolutionary Biology, The University of Kansas, Lawrence, Kansas 66045-2106; 4Geobotanisches Institut ETH, ZuÈ richbergstrasse 38, CH-8044, ZuÈ rich, Switzerland Communicating Editor: Jeff H. Rettig ABSTRACT. The minute, reduced plants of family Lemnaceae have presented a formidable challenge to systematic inves- tigations. The simpli®ed morphology of duckweeds has made it particularly dif®cult to reconcile their interspeci®c relation- ships. A comprehensive phylogenetic analysis of all currently recognized species of Lemnaceae has been carried out using more than 4,700 characters that include data from morphology and anatomy, ¯avonoids, allozymes, and DNA sequences from chloroplast genes (rbcL, matK) and introns (trnK, rpl16). All data are reasonably congruent (I(MF) , 6%) and contributed to strong nodal support in combined analyses. Our combined data yield a single, well-resolved, maximum parsimony tree with 30/36 nodes (83%) supported by bootstrap values that exceed 90%. Subfamily Wolf®oideae is a monophyletic clade with 100% bootstrap support; however, subfamily Lemnoideae represents a paraphyletic grade comprising Landoltia, Lemna,and Spirodela. Combined data analysis con®rms the monophyly of Landoltia, Lemna, Spirodela, Wolf®a,andWolf®ella.
    [Show full text]
  • Differential Effects of Synthetic Media on Long-Term Growth, Starch
    www.nature.com/scientificreports OPEN Diferential efects of synthetic media on long-term growth, starch accumulation and transcription of ADP-glucosepyrophosphorylase subunit genes in Landoltia punctata Chokchai Kittiwongwattana Murashige & Skoog (MS) and Hoagland’s media were previously used for in vitro culture of Landoltia punctata. During subsequent ex vitro culture, the use of MS medium resulted in a higher growth rate, compared to Hoagland’s medium. Thus, a higher starch content of L. punctata in MS medium was previously hypothesized. Here, L. punctata strain 5632 was isolated and characterized using morphological characteristics and the atpF-atpH intergenic region. During early cultivation stage, fresh weight and relative growth rate in MS medium were lower than Hoagland’s medium. Conversely, starch content in MS medium was considerably higher than in Hoagland’s medium. Medium efects on expression of genes coding for starch-biosynthesis ADP-glucosepyrophosphorylase (AGPase) were determined. Genomic fragments of small (LeAPS) and large (LeAPL1) AGPase subunits were characterized. Diferential expression between each AGPase subunit genes was observed in both media. Additionally, in MS medium, the highest correlation coefcients between starch content and gene expression was found with LeAPS (0.81) and followed by LeAPL3 (0.67), LeAPL2 (0.65) and LeAPL1 (0.28). In Hoagland’s medium, the coefcients of LeAPL3 (0.83) and LeAPL2 (0.62) were higher than LeAPS (0.18) and LeAPL1 (−0.62). This suggested diferent levels of contributions of these genes in starch biosynthesis in both media. Starch functions as an important energy reserve in plants1. During photosynthesis, carbon compounds are generated and converted into glucose that serves as the precursor for starch formation1.
    [Show full text]
  • Prevention of Muddy Taints in Farmed Barramundi
    Prevention of muddy taints in farmed Barramundi Sue Poole and Paul Exley Project No. 2009/775 February 2015 This project was conducted by: Department of Agriculture and Fisheries Queensland Government 39 Kessels Road, Coopers Plains, Brisbane In collaboration with: Australian Barramundi Farmers Association PO Box 26, Cooroy, QLD 4563 ISBN: 978 0 7345 0447 0 Copyright, 2012: The Seafood CRC Company Ltd, the Fisheries Research and Development Corporation and [Insert other organisations here]. This work is copyright. Except as permitted under the Copyright Act 1968 (Cth), no part of this publication may be reproduced by any process, electronic or otherwise, without the specific written permission of the copyright owners. Neither may information be stored electronically in any form whatsoever without such permission. The Australian Seafood CRC is established and supported under the Australian Government’s Cooperative Research Centres Program. Other investors in the CRC are the Fisheries Research and Development Corporation, Seafood CRC company members, and supporting participants. Office Mark Oliphant Building, Laffer Drive, Bedford Park SA 5042 Postal Box 26, Mark Oliphant Building, Laffer Drive, Bedford Park SA 5042 Tollfree 1300 732 213 Phone 08 8201 7650 Facsimile 08 8201 7659 Website www.seafoodcrc.com ABN 51 126 074 048 Important Notice Although the Australian Seafood CRC has taken all reasonable care in preparing this report, neither the Seafood CRC nor its officers accept any liability from the interpretation or use of the information set out in this document. Information contained in this document is subject to change without notice. - - 2 - - Non-Technical Summary Seafood CRC 2009/775 Prevention of muddy taints in farmed barramundi PRINCIPAL INVESTIGATOR: Sue Poole Innovative Food Technologies Department of Agriculture and Fisheries Queensland Government [email protected] Mob 0428 101 032 ADDRESS: 39 Kessels Road, Coopers Plains Brisbane QLD 4108 PROJECT OBJECTIVES: 1.
    [Show full text]
  • 0615 Ingredients Column
    [INGREDIENTS] PREVIEW By Karen Nachay and Melanie Zanoza Bartelme Chicago Will Be the Ingredients Capital in July or more than a century, Chicago of candy capital of the world because spices and flavorings for sauces, leav- has been a mecca of food product of the large number of confectionery ening agents and grains for bread, Fdevelopment and culinary explora- manufacturers located in and around antimicrobials to keep meat safe, and tion. The city is even named for a food; the city. And Carl Sandburg in his oils with less saturated fat and more the name Chicago derives from a word poem “Chicago” called the city “hog monounsaturated fat—that and so that local Native Americans gave to butcher for the world,” a reference to much more are all represented. And wild leeks. Chicago’s location on Lake the Union Stock Yards, which from what is a food show without samples? Michigan and the waterways that 1865 until they closed in 1971, pro- Exhibitors plan to feature their top connected it to the Mississippi River cessed more than one billion animals. ingredients in such product concepts as well as it being a central hub for Much of the confection manufac- as Reduced-Sugar Root Beer Craft railroads contributed to the growth of turing has moved elsewhere, and the Soda, Savory Kimchi Pancake, High- industry, including food manufactur- only structure that exists of the infa- Protein Pudding, and Pie-Flavored ing. The significant population growth mous Union Stock Yards is a limestone Milk Shakes. from the mid-19th century through the arch called the Union Stock Yard Gate.
    [Show full text]
  • 2021 Junior Division Finalists' Abstracts
    Junior Division Animal Sciences Raeya Schrock JR-AS-002 Infrared Thermography to Enhance Livestock Health The purpose of the researcher’s project is to become familiar with using thermography and interpreting thermograms as a useful tool for early detection of labor in heifers, heart failure in fat cattle and determining the extent of localized infection. It is predicted that thermal imagining will be able to detect health issues in beef cattle before the problems become apparent to the naked eye. Thermograms were generated using a FLIR ONE Gen 3 Thermal Camera with a MSX Image Enhancement Technology Attachment. The researcher compared pallets “Contrast”, “Iron” and “Hottest”. Thermograms were analyzed to pinpoint inflammation and identify animal distress. Infrared thermographic technology is most accurate and useful at identifying localized inflammation and infected areas where as the accuracy diminishes with distance from the animal. Thermography pointed inside the ear proved to be an accurate indicator of animal temperature. The “Contrast” setting proved more detailed compared to the “iron” pallet. Dorothy Berger JR-AS-003 Pet Stress Management with Music The number of puppies being adopted has dramatically increased in the past year due to the pandemic and many people being stuck at home. The new dog owners are going to need ways to calm and reassure their pets. One easily accessible way is playing music or sounds for the dogs. Little research has been conducted on which specific sounds are calming to dogs in their own home environment. Dog owners in the community were recruited and sent instructions to expose their dogs to four different sound conditions.
    [Show full text]
  • Good Practices for the Feed Sector Implementing the Codex Alimentarius Code of Practice on Good Animal Feeding
    ISSN 1810-1119 [print] ISSN 2070-2493 [online] Good practices for the feed sector Implementing the Codex Alimentarius Code of Practice on Good Animal Feeding FAO ANIMAL PRODUCTION AND HEALTH / MANUAL 24 FAO ANIMAL PRODUCTION AND HEALTH / MANUAL 24 Good practices for the feed sector Implementing the Codex Alimentarius Code of Practice on Good Animal Feeding Editors Angela Pellegrino Missaglia Technical Expert, International Feed Industry Federation (IFIF) Annamaria Bruno Former Senior Food Standards Officer, Codex Alimentarius Commission Secretariat Daniela Battaglia Animal Production Officer, Food and Agriculture Organization of the United Nations (FAO) Published by: Food and Agriculture Organization of the United Nations and International Feed Industry Federation Rome, 2020 Recommended Citation FAO and IFIF. 2020. Good practices for the feed sector – Implementing the Codex Alimentarius Code of Practice on Good Animal Feeding. FAO Animal Production and Health Manual No. 24. Rome. https://doi.org/10.4060/cb1761en The designations employed and the presentation of material in this information product do not imply the expression of any opinion whatsoever on the part of the Food and Agriculture Organization of the United Nations (FAO) or the International Feed Industry Federation (IFIF) concerning the legal or development status of any country, territory, city or area or of its authorities, or concerning the delimitation of its frontiers or boundaries. The mention of specific companies or products of manufacturers, whether or not these have been patented, does not imply that these have been endorsed or recommended by FAO or IFIF in preference to others of a similar nature that are not mentioned. The views expressed in this information product are those of the author(s) and do not necessarily reflect the views or policies of FAO or IFIF.
    [Show full text]
  • The Complete Chloroplast Genome Sequence of Tree of Heaven (Ailanthus Altissima (Mill.) (Sapindales: Simaroubaceae), an Important Pantropical Tree
    International Journal of Molecular Sciences Article The Complete Chloroplast Genome Sequence of Tree of Heaven (Ailanthus altissima (Mill.) (Sapindales: Simaroubaceae), an Important Pantropical Tree Josphat K. Saina 1,2,3,4, Zhi-Zhong Li 2,3, Andrew W. Gichira 2,3,4 and Yi-Ying Liao 1,* 1 Fairy Lake Botanical Garden, Shenzhen & Chinese Academy of Sciences, Shenzhen 518004, China; [email protected] 2 Key Laboratory of Aquatic Botany and Watershed Ecology, Wuhan Botanical Garden, Chinese Academy of Sciences, Wuhan 430074, China; [email protected] (Z.-Z.L.); [email protected] (A.W.G.) 3 University of Chinese Academy of Sciences, Beijing 100049, China 4 Sino-African Joint Research Center, Chinese Academy of Sciences, Wuhan 430074, China * Correspondence: [email protected]; Tel.: +86-150-1949-8243 Received: 31 January 2018; Accepted: 16 March 2018; Published: 21 March 2018 Abstract: Ailanthus altissima (Mill.) Swingle (Simaroubaceae) is a deciduous tree widely distributed throughout temperate regions in China, hence suitable for genetic diversity and evolutionary studies. Previous studies in A. altissima have mainly focused on its biological activities, genetic diversity and genetic structure. However, until now there is no published report regarding genome of this plant species or Simaroubaceae family. Therefore, in this paper, we first characterized A. altissima complete chloroplast genome sequence. The tree of heaven chloroplast genome was found to be a circular molecule 160,815 base pairs (bp) in size and possess a quadripartite structure. The A. altissima chloroplast genome contains 113 unique genes of which 79 and 30 are protein coding and transfer RNA (tRNA) genes respectively and also 4 ribosomal RNA genes (rRNA) with overall GC content of 37.6%.
    [Show full text]
  • Phylogenic Study of Lemnoideae (Duckweeds) Through Complete Chloroplast Genomes for Eight Accessions
    Phylogenic study of Lemnoideae (duckweeds) through complete chloroplast genomes for eight accessions Yanqiang Ding1,2,3,4, Yang Fang1,4, Ling Guo1,3, Zhidan Li1,3, Kaize He1, Yun Zhao2 and Hai Zhao1 1 Chengdu Institute of Biology, Chinese Academy of Sciences, Chengdu, China 2 Key Laboratory of Bio-resource and Eco-environment of Ministry of Education, College of Life Sciences, Sichuan University, Chengdu, China 3 University of Chinese Academy of Sciences, Beijing, China 4 Key Laboratory of Environment and Applied Microbiology, Chinese Academy of Sciences, Chengdu, China ABSTRACT Background. Phylogenetic relationship within different genera of Lemnoideae, a kind of small aquatic monocotyledonous plants, was not well resolved, using either morphological characters or traditional markers. Given that rich genetic information in chloroplast genome makes them particularly useful for phylogenetic studies, we used chloroplast genomes to clarify the phylogeny within Lemnoideae. Methods. DNAs were sequenced with next-generation sequencing. The duckweeds chloroplast genomes were indirectly filtered from the total DNA data, or directly obtained from chloroplast DNA data. To test the reliability of assembling the chloroplast genome based on the filtration of the total DNA, two methods were used to assemble the chloroplast genome of Landoltia punctata strain ZH0202. A phylogenetic tree was built on the basis of the whole chloroplast genome sequences using MrBayes v.3.2.6 and PhyML 3.0. Results. Eight complete duckweeds chloroplast genomes were assembled, with lengths ranging from 165,775 bp to 171,152 bp, and each contains 80 protein-coding sequences, four rRNAs, 30 tRNAs and two pseudogenes. The identity of L. punctata strain Submitted 1 March 2017 ZH0202 chloroplast genomes assembled through two methods was 100%, and their Accepted 2 December 2017 sequences and lengths were completely identical.
    [Show full text]
  • To Download the PDF File
    The effect of community complexity on species performance profiles along a thermal gradient David A.J.S. O'Connor This thesis is submitted to the Faculty of Graduate and Postdoctoral Studies in partial fulfillment of the requirements of the degree of Master of Science in Biology. ©2011 David O'Connor Library and Archives Bibliotheque et 1*1 Canada Archives Canada Published Heritage Direction du Branch Patrimoine de I'edition 395 Wellington Street 395, rue Wellington OttawaONK1A0N4 OttawaONK1A0N4 Canada Canada Your file Votre reference ISBN: 978-0-494-83126-7 Our file Notre r6f6rence ISBN: 978-0-494-83126-7 NOTICE: AVIS: The author has granted a non­ L'auteur a accorde une licence non exclusive exclusive license allowing Library and permettant a la Bibliotheque et Archives Archives Canada to reproduce, Canada de reproduire, publier, archiver, publish, archive, preserve, conserve, sauvegarder, conserver, transmettre au public communicate to the public by par telecommunication ou par I'lnternet, preter, telecommunication or on the Internet, distribuer et vendre des theses partout dans le loan, distribute and sell theses monde, a des fins commerciales ou autres, sur worldwide, for commercial or non­ support microforme, papier, electronique et/ou commercial purposes, in microform, autres formats. paper, electronic and/or any other formats. The author retains copyright L'auteur conserve la propriete du droit d'auteur ownership and moral rights in this et des droits moraux qui protege cette these. Ni thesis. Neither the thesis nor la these ni des extraits substantiels de celle-ci substantial extracts from it may be ne doivent etre imprimes ou autrement printed or otherwise reproduced reproduits sans son autorisation.
    [Show full text]
  • Hide and Seek: Investigation of Biodiversity and Distribution of Cryptic Duckweed Species in Alberta
    HIDE AND SEEK: INVESTIGATION OF BIODIVERSITY AND DISTRIBUTION OF CRYPTIC DUCKWEED SPECIES IN ALBERTA KANISHKA MADUSHANKA SENEVIRATHNA Bachelor of Science, University of Peradeniya Sri Lanka, 2017 A thesis submitted to the School of Graduate Studies of the University of Lethbridge in partial fulfillment of the requirements for the degree MASTER OF SCIENCE in BIOLOGY Department of Biological Sciences University of Lethbridge LETHBRIDGE, ALBERTA, CANADA © Kanishka Madushanka Senevirathna, 2021 HIDE AND SEEK: INVESTIGATION OF BIODIVERSITY AND DISTRIBUTION OF CRYPTIC DUCKWEED SPECIES IN ALBERTA KANISHKA MADUSHANKA SENEVIRATHNA Date of Defense: November 24, 2020 Dr. R. Laird Associate Professor Ph.D. Dr. T. Burg Professor Ph.D. Thesis Co-Supervisor Dr. J. McCune Assistant Professor Ph.D. Thesis Examination Committee Member Dr. S. Wiseman Associate Professor Ph.D. Thesis Examination Committee Member Dr. T. Russell Associate Professor Ph.D. Chair, Thesis Examination Committee Abstract This thesis focused on the development of molecular tools to characterize the biogeographical distribution of two cryptic Lemna species suspected to be present in Alberta, Lemna turionifera and L. minor. I developed eight species‐specific primers for five morphologically similar Lemna species. Our preliminary data show L. minor is present in multiple wetlands in southern Alberta. Subsequently, I used genotyping-by- sequencing technology to study the population diversity of these cryptic Lemna species. Based on analyses of 103 samples at 16,007 single nucleotide polymorphism loci, I provide strong support for genetic diversity existing between L. minor and L. turionifera growing in Alberta. I found significant population differentiation in L. minor but no genetically distinct populations within L. turionifera.
    [Show full text]
  • Importance of Duckweeds in Basic Research and Their Industrial 1 Applications
    Importance of Duckweeds in Basic Research and Their Industrial 1 Applications Paul Fourounjian, Tamra Fakhoorian and Xuan Hieu Cao Abstract fuel prices rose and the US Department of The Lemnaceae family, commonly called Energy funded the sequencing of the Spirodela duckweeds, is 37 species of the smallest and polyrhiza genome. This launched not only the simplest flowering plants found floating on genomic investigations detailed in this book, nutrient-rich waters worldwide. Their small but the regrowth of duckweed industrial size and rapid clonal growth in aseptic condi- applications. Thanks to their ability to quickly tions made them a stable and simple model for absorb nitrogen, phosphorous, and other nutri- plant research especially from 1950 to 1990, ents while removing pathogens and growing at when they were used to study plant physiology a rate of 13–38 dry tons/hectare year in water and biochemistry including auxin synthesis treatment lagoons, scientists are currently and sulfur metabolism. Duckweed research exploring ways that duckweed can convert then saw a resurgence in 2008 when global agricultural and municipal wastewater into clean water and a high-protein animal feed. The potential of these plants for phytoremedi- ation of heavy metals and organic compounds fi This chapter was revised and signi cantly expanded also allows the possibility to clean the wastew- upon, with the guidance of T. F., from the chapter “The Importance and Potential of Duckweeds as a Model and ater from heavy industry while providing Crop Plant for Biomass-Based Applications and biofuels and even plastics. Finally, thanks to ” Beyond, in the Handbook on Environmental Materials their superb nutritional profile Wolffia species Management, which X.
    [Show full text]