Anti-MAS1L Antibody (ARG66799)

Total Page:16

File Type:pdf, Size:1020Kb

Anti-MAS1L Antibody (ARG66799) Product datasheet [email protected] ARG66799 Package: 100 μl anti-MAS1L antibody Store at: -20°C Summary Product Description Rabbit Polyclonal antibody recognizes MAS1L Tested Reactivity Hu, Ms, Rat Tested Application WB Host Rabbit Clonality Polyclonal Isotype IgG Target Name MAS1L Antigen Species Human Immunogen KLH-conjugated synthetic peptide within the center region of Human MAS1L. Conjugation Un-conjugated Alternate Names MAS-L; Mas-related G-protein coupled receptor MRG; dJ994E9.2; MRG; MAS-R; MAS1-like Application Instructions Application table Application Dilution WB 1:500 - 1:1000 Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. Calculated Mw 42 kDa Observed Size ~ 39 kDa Properties Form Liquid Purification Affinity purification with immunogen. Buffer 0.42% Potassium phosphate (pH 7.3), 0.87% NaCl, 0.01% Sodium azide and 30% Glycerol. Preservative 0.01% Sodium azide Stabilizer 30% Glycerol Storage instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. Note For laboratory research only, not for drug, diagnostic or other use. www.arigobio.com 1/2 Bioinformation Gene Symbol MAS1L Gene Full Name MAS1 proto-oncogene like, G protein-coupled receptor Cellular Localization Cell membrane; Multi-pass membrane protein. [UniProt] Images ARG66799 anti-MAS1L antibody WB image Western blot: HeLa, H446, Mouse lung, Mouse testis and Rat lung lysates stained with ARG66799 anti-MAS1L antibody. www.arigobio.com 2/2 Powered by TCPDF (www.tcpdf.org).
Recommended publications
  • Transcriptomic Analysis of Native Versus Cultured Human and Mouse Dorsal Root Ganglia Focused on Pharmacological Targets Short
    bioRxiv preprint doi: https://doi.org/10.1101/766865; this version posted September 12, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-ND 4.0 International license. Transcriptomic analysis of native versus cultured human and mouse dorsal root ganglia focused on pharmacological targets Short title: Comparative transcriptomics of acutely dissected versus cultured DRGs Andi Wangzhou1, Lisa A. McIlvried2, Candler Paige1, Paulino Barragan-Iglesias1, Carolyn A. Guzman1, Gregory Dussor1, Pradipta R. Ray1,#, Robert W. Gereau IV2, # and Theodore J. Price1, # 1The University of Texas at Dallas, School of Behavioral and Brain Sciences and Center for Advanced Pain Studies, 800 W Campbell Rd. Richardson, TX, 75080, USA 2Washington University Pain Center and Department of Anesthesiology, Washington University School of Medicine # corresponding authors [email protected], [email protected] and [email protected] Funding: NIH grants T32DA007261 (LM); NS065926 and NS102161 (TJP); NS106953 and NS042595 (RWG). The authors declare no conflicts of interest Author Contributions Conceived of the Project: PRR, RWG IV and TJP Performed Experiments: AW, LAM, CP, PB-I Supervised Experiments: GD, RWG IV, TJP Analyzed Data: AW, LAM, CP, CAG, PRR Supervised Bioinformatics Analysis: PRR Drew Figures: AW, PRR Wrote and Edited Manuscript: AW, LAM, CP, GD, PRR, RWG IV, TJP All authors approved the final version of the manuscript. 1 bioRxiv preprint doi: https://doi.org/10.1101/766865; this version posted September 12, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity.
    [Show full text]
  • Functional Parsing of Driver Mutations in the Colorectal Cancer Genome Reveals Numerous Suppressors of Anchorage-Independent
    Supplementary information Functional parsing of driver mutations in the colorectal cancer genome reveals numerous suppressors of anchorage-independent growth Ugur Eskiocak1, Sang Bum Kim1, Peter Ly1, Andres I. Roig1, Sebastian Biglione1, Kakajan Komurov2, Crystal Cornelius1, Woodring E. Wright1, Michael A. White1, and Jerry W. Shay1. 1Department of Cell Biology, University of Texas Southwestern Medical Center, 5323 Harry Hines Boulevard, Dallas, TX 75390-9039. 2Department of Systems Biology, University of Texas M.D. Anderson Cancer Center, Houston, TX 77054. Supplementary Figure S1. K-rasV12 expressing cells are resistant to p53 induced apoptosis. Whole-cell extracts from immortalized K-rasV12 or p53 down regulated HCECs were immunoblotted with p53 and its down-stream effectors after 10 Gy gamma-radiation. ! Supplementary Figure S2. Quantitative validation of selected shRNAs for their ability to enhance soft-agar growth of immortalized shTP53 expressing HCECs. Each bar represents 8 data points (quadruplicates from two separate experiments). Arrows denote shRNAs that failed to enhance anchorage-independent growth in a statistically significant manner. Enhancement for all other shRNAs were significant (two tailed Studentʼs t-test, compared to none, mean ± s.e.m., P<0.05)." ! Supplementary Figure S3. Ability of shRNAs to knockdown expression was demonstrated by A, immunoblotting for K-ras or B-E, Quantitative RT-PCR for ERICH1, PTPRU, SLC22A15 and SLC44A4 48 hours after transfection into 293FT cells. Two out of 23 tested shRNAs did not provide any knockdown. " ! Supplementary Figure S4. shRNAs against A, PTEN and B, NF1 do not enhance soft agar growth in HCECs without oncogenic manipulations (Student!s t-test, compared to none, mean ± s.e.m., ns= non-significant).
    [Show full text]
  • G Protein-Coupled Receptors
    S.P.H. Alexander et al. The Concise Guide to PHARMACOLOGY 2015/16: G protein-coupled receptors. British Journal of Pharmacology (2015) 172, 5744–5869 THE CONCISE GUIDE TO PHARMACOLOGY 2015/16: G protein-coupled receptors Stephen PH Alexander1, Anthony P Davenport2, Eamonn Kelly3, Neil Marrion3, John A Peters4, Helen E Benson5, Elena Faccenda5, Adam J Pawson5, Joanna L Sharman5, Christopher Southan5, Jamie A Davies5 and CGTP Collaborators 1School of Biomedical Sciences, University of Nottingham Medical School, Nottingham, NG7 2UH, UK, 2Clinical Pharmacology Unit, University of Cambridge, Cambridge, CB2 0QQ, UK, 3School of Physiology and Pharmacology, University of Bristol, Bristol, BS8 1TD, UK, 4Neuroscience Division, Medical Education Institute, Ninewells Hospital and Medical School, University of Dundee, Dundee, DD1 9SY, UK, 5Centre for Integrative Physiology, University of Edinburgh, Edinburgh, EH8 9XD, UK Abstract The Concise Guide to PHARMACOLOGY 2015/16 provides concise overviews of the key properties of over 1750 human drug targets with their pharmacology, plus links to an open access knowledgebase of drug targets and their ligands (www.guidetopharmacology.org), which provides more detailed views of target and ligand properties. The full contents can be found at http://onlinelibrary.wiley.com/doi/ 10.1111/bph.13348/full. G protein-coupled receptors are one of the eight major pharmacological targets into which the Guide is divided, with the others being: ligand-gated ion channels, voltage-gated ion channels, other ion channels, nuclear hormone receptors, catalytic receptors, enzymes and transporters. These are presented with nomenclature guidance and summary information on the best available pharmacological tools, alongside key references and suggestions for further reading.
    [Show full text]
  • Supplementary Table 1: Differentially Methylated Genes and Functions of the Genes Before/After Treatment with A) Doxorubicin and B) FUMI and in C) Responders Vs
    Supplementary Table 1: Differentially methylated genes and functions of the genes before/after treatment with a) doxorubicin and b) FUMI and in c) responders vs. non- responders for doxorubicin and d) FUMI Differentially methylated genes before/after treatment a. Doxo GENE FUNCTION CCL5, CCL8, CCL15, CCL21, CCR1, CD33, IL5, immunoregulatory and inflammatory processes IL8, IL24, IL26, TNFSF11 CCNA1, CCND2, CDKN2A cell cycle regulators ESR1, FGF2, FGF14, FGF18 growth factors WT1, RASSF5, RASSF6 tumor suppressor b. FUMI GENE FUNCTION CCL7, CCL15, CD28, CD33, CD40, CD69, TNFSF18 immunoregulatory and inflammatory processes CCND2, CDKN2A cell cycle regulators IGF2BP1, IGFBP3 growth factors HOXB4, HOXB6, HOXC8 regulation of cell transcription WT1, RASSF6 tumor suppressor Differentially methylated genes in responders vs. non-responders c. Doxo GENE FUNCTION CBR1, CCL4, CCL8, CCR1, CCR7, CD1A, CD1B, immunoregulatory and inflammatory processes CD1D, CD1E, CD33, CD40, IL5, IL8, IL20, IL22, TLR4 CCNA1, CCND2, CDKN2A cell cycle regulators ESR2, ERBB3, FGF11, FGF12, FGF14, FGF17 growth factors WNT4, WNT16, WNT10A implicated in oncogenesis TNFSF12, TNFSF15 apoptosis FOXL1, FOXL2, FOSL1,HOXA2, HOXA7, HOXA11, HOXA13, HOXB4, HOXB6, HOXB8, HOXB9, HOXC8, regulation of cell transcription HOXD8, HOXD9, HOXD11 GSTP1, MGMT DNA repair APC, WT1 tumor suppressor d. FUMI GENE FUNCTION CCL1, CCL3, CCL5,CCL14, CD1B, CD33, CD40, CD69, immunoregulatory and inflammatory IL20, IL32 processes CCNA1, CCND2, CDKN2A cell cycle regulators IGF2BP1, IGFBP3, IGFBP7, EGFR, ESR2,RARB2
    [Show full text]
  • Initial, Transient, and Specific Interaction Between G Protein
    Sato T. et al. Medical Research Archives, vol. 6, issue 9, September 2018 Page 1 of 25 ARTICLE Initial, transient, and specific interaction between G protein-coupled receptor and target G protein in parallel signal processing: a case of olfactory discrimination of cancer-induced odors Takaaki Sato1, Mutsumi Matsukawa2, Yoichi Mizutani3, Toshio Iijima4, Hiroyoshi Matsumura5 Authors’ affiliations: 1 Biomedical Research Institute, National Institute of Advanced Industrial Science and Technology, Osaka, Japan 2 Division of Anatomical Science, Department of Functional Morphology, Nihon University School of Medicine, Tokyo, Japan 3 Department of Medical Engineering, Faculty of Health Science, Aino University, Osaka, Japan 4 Graduate School of Life Sciences, Tohoku University, Sendai, Japan 5 College of Life Sciences, Ritsumeikan University, Kusatsu, Japan * Corresponding author: Takaaki Sato, Biomedical Research Institute, National Institute of Ad- vanced Industrial Science and Technology, 1-8-31 Midorioka, Ikeda, Osaka 563-8577, Japan, E-mail: [email protected] Abstract: G protein-coupled receptors (GPCRs) detect and distinguish between various subtypes of extracellular sig- nals, such as neurotransmitters, hormones, light, and odorous chemicals. As determinants for robust and appropriate cellular responses, common and unique features of interactions between GPCRs and their target G proteins provide insights into structure-based drug design for treatment of GPCR-related diseases. Re- cently, we found that the hydrophobic core buried between GPCR helix 8 and TM1–2 is essential for acti- vation of both specific and nonspecific G proteins. Furthermore, the 2nd residue of helix 8 is responsible for initial, transient, and specific interaction with a target G protein. Analysis of human and murine olfactory receptors (ORs) and other class-A GPCRs revealed that several amino acids, such as Glu, Gln, and Asp, are conserved at this position.
    [Show full text]
  • G Protein-Coupled Receptors
    Alexander, S. P. H., Christopoulos, A., Davenport, A. P., Kelly, E., Marrion, N. V., Peters, J. A., Faccenda, E., Harding, S. D., Pawson, A. J., Sharman, J. L., Southan, C., Davies, J. A. (2017). THE CONCISE GUIDE TO PHARMACOLOGY 2017/18: G protein-coupled receptors. British Journal of Pharmacology, 174, S17-S129. https://doi.org/10.1111/bph.13878 Publisher's PDF, also known as Version of record License (if available): CC BY Link to published version (if available): 10.1111/bph.13878 Link to publication record in Explore Bristol Research PDF-document This is the final published version of the article (version of record). It first appeared online via Wiley at https://doi.org/10.1111/bph.13878 . Please refer to any applicable terms of use of the publisher. University of Bristol - Explore Bristol Research General rights This document is made available in accordance with publisher policies. Please cite only the published version using the reference above. Full terms of use are available: http://www.bristol.ac.uk/red/research-policy/pure/user-guides/ebr-terms/ S.P.H. Alexander et al. The Concise Guide to PHARMACOLOGY 2017/18: G protein-coupled receptors. British Journal of Pharmacology (2017) 174, S17–S129 THE CONCISE GUIDE TO PHARMACOLOGY 2017/18: G protein-coupled receptors Stephen PH Alexander1, Arthur Christopoulos2, Anthony P Davenport3, Eamonn Kelly4, Neil V Marrion4, John A Peters5, Elena Faccenda6, Simon D Harding6,AdamJPawson6, Joanna L Sharman6, Christopher Southan6, Jamie A Davies6 and CGTP Collaborators 1 School of Life Sciences,
    [Show full text]
  • MAS1L (D-13): Sc-107718
    SANTA CRUZ BIOTECHNOLOGY, INC. MAS1L (D-13): sc-107718 The Power to Question BACKGROUND SOURCE The proto-oncogene MAS1 is a G protein-coupled receptor located on the MAS1L (D-13) is an affinity purified goat polyclonal antibody raised against plasma membrane. In transfected NIH/3T3 cells, MAS1 has a weak focus- a peptide mapping within a C-terminal cytoplasmic domain of MAS1L of inducing activity. MAS1 is an antagonist of the AT1 receptor (Angiotensin II human origin. type 1 receptor), inhibiting the actions of Angiotensin II. MAS1L (MAS1-like), also known as MAS-L or MRG (Mas-related G-protein coupled receptor MRG), PRODUCT is a 378 amino acid multi-pass membrane protein that belongs to the G-pro- Each vial contains 200 µg IgG in 1.0 ml of PBS with < 0.1% sodium azide tein coupled receptor 1 (GPCR) family. MAS1 related proteins are thought to and 0.1% gelatin. regulate nociceptor function and development, including the sensation or modulation of pain. Blocking peptide available for competition studies, sc-107718 P, (100 µg peptide in 0.5 ml PBS containing < 0.1% sodium azide and 0.2% BSA). REFERENCES APPLICATIONS 1. Monnot, C., Weber, V., Stinnakre, J., Bihoreau, C., Teutsch, B., Corvol, P. and Clauser, E. 1991. Cloning and functional characterization of a novel MAS1L (D-13) is recommended for detection of MAS1L of human origin Mas-related gene, modulating intracellular Angiotensin II actions. Mol. by Western Blotting (starting dilution 1:200, dilution range 1:100-1:1000), Endocrinol. 5: 1477-1487. immunofluorescence (starting dilution 1:50, dilution range 1:50-1:500) and solid phase ELISA (starting dilution 1:30, dilution range 1:30-1:3000).
    [Show full text]
  • Functional Signature Ontology-Based Identification and Validation of Novel Therapeutic Targets and Natural Products for the Treatment of Cancer
    University of Nebraska Medical Center DigitalCommons@UNMC Theses & Dissertations Graduate Studies Spring 5-5-2018 Functional Signature Ontology-Based Identification and alidationV of Novel Therapeutic Targets and Natural Products for the Treatment of Cancer Beth Neilsen University of Nebraska Medical Center Follow this and additional works at: https://digitalcommons.unmc.edu/etd Part of the Bioinformatics Commons, Cancer Biology Commons, and the Oncology Commons Recommended Citation Neilsen, Beth, "Functional Signature Ontology-Based Identification and alidationV of Novel Therapeutic Targets and Natural Products for the Treatment of Cancer" (2018). Theses & Dissertations. 268. https://digitalcommons.unmc.edu/etd/268 This Dissertation is brought to you for free and open access by the Graduate Studies at DigitalCommons@UNMC. It has been accepted for inclusion in Theses & Dissertations by an authorized administrator of DigitalCommons@UNMC. For more information, please contact [email protected]. Functional Signature Ontology-Based Identification and Validation of Novel Therapeutic Targets and Natural Products for the Treatment of Cancer By Beth K. Neilsen A DISSERTATION Presented to the Faculty of the University of Nebraska Graduate College in Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy Cancer Research Graduate Program Under the Supervision of Professor Robert E. Lewis University of Nebraska Medical Center Omaha, Nebraska May 2018 Supervisory Committee: Jennifer Black, Ph.D. Jing (Jenny) Wang, Ph.D. Allison Cushman-Vokoun, M.D./Ph.D. Juan Cui, Ph.D. ii To my parents, Dr. and Mrs. Mitchell and Rebecca Neilsen, For always encouraging me to think critically, pushing me to be the best version of me, for giving me the space to think for myself, teaching me compassion, and most importantly, for molding me into the person I am today.
    [Show full text]
  • Oxygenated Fatty Acids Enhance Hematopoiesis Via the Receptor GPR132
    Oxygenated Fatty Acids Enhance Hematopoiesis via the Receptor GPR132 The Harvard community has made this article openly available. Please share how this access benefits you. Your story matters Citation Lahvic, Jamie L. 2017. Oxygenated Fatty Acids Enhance Hematopoiesis via the Receptor GPR132. Doctoral dissertation, Harvard University, Graduate School of Arts & Sciences. Citable link http://nrs.harvard.edu/urn-3:HUL.InstRepos:42061504 Terms of Use This article was downloaded from Harvard University’s DASH repository, and is made available under the terms and conditions applicable to Other Posted Material, as set forth at http:// nrs.harvard.edu/urn-3:HUL.InstRepos:dash.current.terms-of- use#LAA Oxygenated Fatty Acids Enhance Hematopoiesis via the Receptor GPR132 A dissertation presented by Jamie L. Lahvic to The Division of Medical Sciences in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the subject of Developmental and Regenerative Biology Harvard University Cambridge, Massachusetts May 2017 © 2017 Jamie L. Lahvic All rights reserved. Dissertation Advisor: Leonard I. Zon Jamie L. Lahvic Oxygenated Fatty Acids Enhance Hematopoiesis via the Receptor GPR132 Abstract After their specification in early development, hematopoietic stem cells (HSCs) maintain the entire blood system throughout adulthood as well as upon transplantation. The processes of HSC specification, renewal, and homing to the niche are regulated by protein, as well as lipid signaling molecules. A screen for chemical enhancers of marrow transplant in the zebrafish identified the endogenous lipid signaling molecule 11,12-epoxyeicosatrienoic acid (11,12-EET). EET has vasodilatory properties, but had no previously described function on HSCs.
    [Show full text]
  • G Protein‐Coupled Receptors
    S.P.H. Alexander et al. The Concise Guide to PHARMACOLOGY 2019/20: G protein-coupled receptors. British Journal of Pharmacology (2019) 176, S21–S141 THE CONCISE GUIDE TO PHARMACOLOGY 2019/20: G protein-coupled receptors Stephen PH Alexander1 , Arthur Christopoulos2 , Anthony P Davenport3 , Eamonn Kelly4, Alistair Mathie5 , John A Peters6 , Emma L Veale5 ,JaneFArmstrong7 , Elena Faccenda7 ,SimonDHarding7 ,AdamJPawson7 , Joanna L Sharman7 , Christopher Southan7 , Jamie A Davies7 and CGTP Collaborators 1School of Life Sciences, University of Nottingham Medical School, Nottingham, NG7 2UH, UK 2Monash Institute of Pharmaceutical Sciences and Department of Pharmacology, Monash University, Parkville, Victoria 3052, Australia 3Clinical Pharmacology Unit, University of Cambridge, Cambridge, CB2 0QQ, UK 4School of Physiology, Pharmacology and Neuroscience, University of Bristol, Bristol, BS8 1TD, UK 5Medway School of Pharmacy, The Universities of Greenwich and Kent at Medway, Anson Building, Central Avenue, Chatham Maritime, Chatham, Kent, ME4 4TB, UK 6Neuroscience Division, Medical Education Institute, Ninewells Hospital and Medical School, University of Dundee, Dundee, DD1 9SY, UK 7Centre for Discovery Brain Sciences, University of Edinburgh, Edinburgh, EH8 9XD, UK Abstract The Concise Guide to PHARMACOLOGY 2019/20 is the fourth in this series of biennial publications. The Concise Guide provides concise overviews of the key properties of nearly 1800 human drug targets with an emphasis on selective pharmacology (where available), plus links to the open access knowledgebase source of drug targets and their ligands (www.guidetopharmacology.org), which provides more detailed views of target and ligand properties. Although the Concise Guide represents approximately 400 pages, the material presented is substantially reduced compared to information and links presented on the website.
    [Show full text]
  • An Evolutionary Medicine Perspective on Neandertal Extinction
    Supplementary Information (Figures and Tables) for: An evolutionary medicine perspective on Neandertal extinction Alexis P. Sullivan1, Marc de Manuel3, Tomas Marques-Bonet3,4,5, & George H. Perry1,2 Departments of 1Biology and 2Anthropology, Pennsylvania State University, University Park, PA 16802, USA 3Institut de Biologia Evolutiva (CSIC/UPF), Parque de Investigación Biomédica de Barcelona (PRBB), Barcelona, Catalonia 08003, Spain 4CNAG-CRG, Centre for Genomic Regulation (CRG), Barcelona Institute of Science and Technology (BIST), Baldiri i Reixac 4, 08028 Barcelona, Spain 5Catalan Institution of Research and Advanced Studies (ICREA), Passeig de Lluís Companys, 23, 08010, Barcelona, Spain Corresponding Author: George H. Perry E-mail: [email protected] Supplemental Figure 1: Innate immune system gene permutation analyses – 10,000 sets of 73 randomly selected genes containing nonsynonymous SNPs Supplemental Figure 2: Virus-interacting protein gene permutation analyses – 10,000 sets of 164 randomly selected genes containing nonsynonymous SNPs Supplemental Figure 3: MHC gene permutation analyses – 10,000 sets of 13 randomly selected genes containing nonsynonymous SNPs Supplemental Figure 4: Patterns of Neandertal and modern human nonsynonymous SNP diversity in MHC genes (n = 13) excluding the Altai Neandertal and one random modern human per population Supplemental Figure 5: Significantly enriched gene ontology categories (red) among top 1% ape diversity genes Supplemental Table 1: A comparison of genome-wide nonsynonymous SNPs versus total (nonsynonymous
    [Show full text]
  • PRODUCT SPECIFICATION Anti-MAS1L Product
    Anti-MAS1L Product Datasheet Polyclonal Antibody PRODUCT SPECIFICATION Product Name Anti-MAS1L Product Number HPA017983 Gene Description MAS1 proto-oncogene like, G protein-coupled receptor Clonality Polyclonal Isotype IgG Host Rabbit Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: ICWFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNE TNETIHMQMSMAVGQQALPLNIIA Purification Method Affinity purified using the PrEST antigen as affinity ligand Verified Species Human Reactivity Recommended IHC (Immunohistochemistry) Applications - Antibody dilution: 1:500 - 1:1000 - Retrieval method: HIER pH6 ICC-IF (Immunofluorescence) - Fixation/Permeabilization: PFA/Triton X-100 - Working concentration: 0.25-2 µg/ml Characterization Data Available at atlasantibodies.com/products/HPA017983 Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Concentration Lot dependent Storage Store at +4°C for short term storage. Long time storage is recommended at -20°C. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. For protocols, additional product information, such as images and references, see atlasantibodies.com. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions. Atlas Antibodies AB's sole liability is limited to replacement of the product or refund of the purchase price.
    [Show full text]