DOCSLIB.ORG

Ete Indien Headlines 100K Bob Umphrey Turf Sprint

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Ete Indien Headlines 100K Bob Umphrey Turf Sprint Saturday & Sunday • July 3 & 4, 2021 FEC/FTBOA PUBLICATION www.wiretowire.net FLORIDA’SDAILYRACINGDIGEST FOR ADVERTISING INFORMATION or to subscribe, please call Antoinette at 352-732-8858 or email: [email protected] In This Issue: Three Tracks Comprise Saturday’s Cross Country Pick 5 Firenze Fire Out to Defend His Home Court in G2 John A. Nerud Canadian Mighty Heart Triumphant in Dominion Day Stakes It’s a Gamble Ready for Action in $100K Manila Ete Indien/RYAN THOMPSON PHOTO Camacho Wins 3rd Jockeys’ Challenge Track Results & Entries Ete Indien Headlines 100k Florida Stallion Progeny List Bob Umphrey Turf Sprint Florida Breeders’ List Wire to Wire Business Place GULFSTREAM PARK PRESS OFFICE Ete Indien was a leading 3-year-old last year after setting the pace to finish second HALLANDALE BEACH, FL – A prominent behind Tiz the Law in the Holy Bull (G2) prospect on the Road to the Triple Crown and capturing the Fountain of Youth (G2) Featured last year before going to the sidelines, Ete by eight-and-a-half lengths. The son of Indien is scheduled to make his first start Summer Front went on to finish third Advertisers in more than a year in Sunday’s $100,000 behind Tiz the Law after setting a pres- Bob Umphrey Turf Sprint at Gulfstream sured early pace in the Florida Derby (G1). Big Lick Farm Park. Unfortunately, due to the Covid-19 pan- The Umphrey, a five-furlong turf sprint demic, the Kentucky Derby (G1) and Equistaff Inc. that offers a $25,000 ‘Win Only’ bonus to Preakness Stakes (G1) were postponed Florida-bred entrants, is featured on from their traditional May dates. Florida Department of Agriculture Sunday’s Fourth of July program, wrap- “For us, it was very disappointing ping up Summit of Speed Weekend, which because my two horses – he and Sole FTBOA will be highlighted by the $350,000 Volante – were at the top of their game,” Ocala Breeders’ Feed & Supply Princess Rooney Invitational (G2) and the trainer Patrick Biancone said. “Everything $200,000 Smile Sprint Invitational (G3) on changed. One got hurt and the other one Seminole Feed Saturday’s card. See TURF SPRINT on page 3 Wire to Wire July 3 & 4, 2021 Back to Top Page 3 Turf Sprint Continued from COVER lost his form. But the racetracks were great, protecting everybody and keeping them safe and keeping everybody working.” Ete Indien would race only once more last year in a June optional claiming allowance, weakening to finish fourth behind stablemate Sole Volante after setting a pressured pace. “He’s trained extremely well, but when you have not run for a year, you cannot expect to have the horse super-tight. He had a lit- tle hiccup, and he’s recovered from everything now. He’s happy, sound and very strong,” Biancone said. “He strained one of his ankles. He should have been ready to run in March, but unfortu- nately, one morning, he put his legs over the [stall] door and I lost another three months.” Biancone is happy with what he sees in Ete Indien one full year after he established himself as one of the best 3-year-olds in the country. “He’s gorgeous; he’s really matured. He’s 16 hands. He’s a monster,” said Biancone, who owns Ete Indien with Linda Shanahan, Sanford Bacon, Dream With Me Stable Inc., Horse France America and D P Racing. Ete Indien has already had success on turf at the five-furlong distance, having closed from off the pace to capture his career debut in September 2019. The Kentucky-bred colt finished off the board following an extremely wide trip in the Bourbon (G3) over Keeneland’s turf course in his second start. He rebounded in his dirt debut next time out, scoring a front-running two-and-a-half length optional claiming allowance that preceded his most encouraging performances in the Holy Bull, Fountain of Youth and Florida Derby. “I like the five furlongs on turf for a comeback because it’s not too hard on them,” Biancone. “We go back to scratch. He’s had a year off. We got back to where he started.” Florent Geroux, who was aboard for Ete Indien’s Fountain of Youth romp, has the call. Glen Hill Farm’s Caribou Club, a multiple graded stakes-win- ning 7-year-old gelding with more than $700,000 in earnings, looms as a strong contender in the Umphrey after notching a vic- tory in his first career start at the five-furlong distance on turf in a May 22 overnight handicap at Gulfstream. Edwin Gonzalez has the return call on Caribou Club. Caribou Club, a Florida-bred son of City Zip, is eligible for the $25,000 Florida-bred “Win Only’ bonus, as are Imaginary Stables’ Harry’s Ontheloose, Hibiscus Stables LLC’s Tiger Blood, Just for Fun Stable Inc.’s Warrior’s Pride and Golden Kernel Racing Stable’s Yes I Am Free. Lea Farms LLC’s Citrus Burst, Chester Bishop’s Brother Satchmo and Imaginary Stables’ Nitro Time round out the main body of the field. Vicente Stella Stables LLC’s Sovereign Warrior is on the also-eligible list. Reeves Thoroughbred Racing’s Ournationonparade and Averill Racing and partners’ R Mercedes Boy are main-track-only entrants. CLICK HERE for the latest The Florida Horse ONLINE Wire to Wire July 3 & 4, 2021 Back to Top Wire to Wire July 3 & 4, 2021 Back to Top Page 5 Belmont Park, Woodbine Racetrack and Delaware Park Comprise Saturday’s Cross Country Pick 5 BY KEITH MCCALMONT, NYRA PRESS OFFICE ________________________________ The New York Racing Association Inc. [NYRA] will host a Cross Country Pick 5 on Saturday featuring racing action from Belmont Park, Woodbine Racetrack and Delaware Park. Free Equibase past performances for the Cross Country Pick 5 sequence are available for download at https://www.nyra.com/bel- mont/racing/cross-country-wagers. Saturday’s sequence kicks off in race seven at 4:21 pm Eastern with a mile-and-a-sixteenth allowance event for 3-year-olds and up on the Woodbine Tapeta. A talented field of 11 will see the 2020 Coronation Futurity- winner Stephen commence his path to the Queen’s Plate for trainer Kevin Attard against a group of older horses led by the Josie Carroll-trained Belichick, who finished second in last year’s Queen’s Plate in September ahead of a four-length score in the Breeders’ in October at Woodbine, the third and final leg of the Canadian Triple Crown. Action switches to Belmont for the second leg [race eight, 4:40 pm], a mile-and-a-sixteenth optional-claiming event on the inner turf for sophomores featuring the grass debut of Woodslane Farm’s Wolfie’s Dynaghost, a half-brother to multiple graded stakes win- ning turf specialist Sadler’s Joy. A deep field of contenders includes the graded-stakes placed Shawdyshawdyshawdy, who finished third last out in the off-the-turf Grade 3 Pennine Ridge; and the stakes-placed Space Launch, the third-place finisher in the Awad in October over yielding turf at Belmont. The middle leg begins the stakes portion of the sequence with the Grade 3, $300,000 Delaware Oaks [race eight, 4:45 pm], a mile-and-a-sixteenth test for sophomore fillies topped by 6-5 morning-line favorite Crazy Beautiful for trainer Kenny McPeek. The Liam’s Map gray captured the Grade 2 Gulfstream Park Oaks in March and last out won the Grade 2 Summertime Oaks on May 30 at Santa Anita Park. The penultimate leg will mark the seasonal debut of Juddmonte Farms’ Viadera in the $100,000 Perfect Sting [race nine, 5:12 pm], a one-mile Widener turf test for older fillies and mares at Belmont. Trained by four-time Eclipse Award-winner Chad Brown, Viadera won 3-of-4 starts last year, including a nose score in the Grade 1 Matriarch last out in November at Del Mar. Closing out the sequence is a mile-and-a-sixteenth optional- claiming event [race nine, 5:22 pm] for fillies and mares 3-years- old and up on the E.P. Taylor Turf Course at Woodbine. Hall of Fame trainer Mark Casse sends out a trio of contenders in multiple graded stakes placed Art of Almost [21-3-5-5, $239,448], the improving Florida-bred Tappitty Tappitty [9-2-3-1, $98,246] and the consistent Preferred Guest [17-3-5-3, $232,809]. The minimum bet for the multi-track, multi-race wager is 50 cents. Wagering on the Cross Country Pick 5 is also available on ADW platforms and at simulcast facilities across the country. Every week will feature a mandatory payout of the net pool. The Cross Country Pick 5 will continue each Saturday throughout the year. For more information, visit NYRABets.com. Buy / Breed / Race / Sell Florida-breds! Wire to Wire July 3 & 4, 2021 Back to Top Wire to Wire July 3 & 4, 2021 Back to Top Page 7 Firenze Fire Out to Defend His Home Court in G2 John A. Nerud BY RYAN MARTIN, past five seasons, register- NYRA PRESS OFFICE__ ing a career-best 107 Beyer Speed Figure during his Through a 33-race sophomore campaign when career, nine-time graded- returning to Belmont with a stakes winner Firenze Fire nine-length romp in the has asserted his talent over 2018 Grade 3 Dwyer. seven different racetracks, Following a successful but it’s no secret that the 2019 campaign, which veteran son of Poseidon’s included a victory in the Warrior has an affinity for Runhappy at Belmont, Belmont Park.
Load more

Recommended publications
  • Mating Analysis Liam's
    MATING ANALYSIS You may submit your mare online at lanesend.com or call 859-873-7300 to discuss your matings with CHANCE TIMM, [email protected], JILL MCCULLY, [email protected] or LEVANA CAPRIA, [email protected]. LIAM’S MAP Unbridled’s Song - Miss Macy Sue, by Trippi 2011 Gray/roan | 16.1 1/2 Hands Liam’s Map possesses a unique pedigree that gives him an outstanding chance of carrying on the male line of the great sire Unbridled’s Song. His second dam, Yada Yada, by Great Above, is inbred 2x3 to the great racemare and broodmare Ta Wee. That pattern of having a closely inbred ancestor close up, whether it be broodmare sire or along the tail- female line, is a pedigree pattern that has appeared repeatedly in the pedigrees of great racehorses and line-founding sires since the dawn of thoroughbred history, beginning with the horse generally considered the first great racehorse Flying Childers, whose full brother Bartlett’s Childers is the grandsire of Eclipse, tail-male ancestor of more than 95% of modern Thoroughbreds. The most recent example is the unexpected leading sire Distorted Humor, whose second dam is inbred 3x3 to Turn-to. Since Unbridled’s Song’s sire Unbridled is also inbred 4x4 to Aspidistra, through her immortal son Dr. Fager (sire of the dam of Unbridled’s sire Fappiano) and his half-sister Magic, by Buckpasser, Unbridled’s third dam, that means Liam’s Map carries four crosses of one of the most influential broodmares of the 20th century, Aspidistra. With any new stallion it is always a good idea to reinforce the most important strains of his pedigree, and it is abundantly clear that Aspidistra’s influence was critical to the excellence of Liam’s Map.
    [Show full text]
  • GRAY OR ROAN FILLY Barn 5 Hip No
    Consigned by Denali Stud (Craig & Holly Bandoroff), Agent for Stonestreet Bred & Raised Barn GRAY OR ROAN FILLY Hip No. 5 Foaled March 5, 2016 147 A.P. Indy Pulpit ................................ Preach Tapit .................................. Unbridled Tap Your Heels .................. Ruby Slippers GRAY OR Storm Bird ROAN FILLY Storm Cat .......................... Terlingua Cat Dancer ........................ (2002) Fappiano Foppy Dancer .................... Water Dance By TAPIT (2001). Black-type winner of $557,300, Wood Memorial S. [G1] (AQU, $450,000), etc. Leading sire 3 times, sire of 10 crops of racing age, 1143 foals, 861 starters, 98 black-type winners, 652 winners of 1912 races and earning $114,394,954, 6 champions, including Untapable ($3,926,- 625, Longines Breeders' Cup Distaff [G1] (SA, $1,100,000), etc.), Stardom Bound ($1,861,610, Breeders' Cup Juvenile Fillies [G1] (OSA, $1,080,- 000), etc.), Hansen [G1] ($1,810,805), and of Tonalist [G1] ($3,647,000). 1st dam CAT DANCER, by Storm Cat. Winner at 3, $53,465. Sister to MAGIC STORM . Dam of 8 other registered foals, 8 of racing age, including a 2-year-old of 2017, 5 to race, 4 winners, including-- DRILL (c. by Lawyer Ron). 4 wins at 2 and 3, $557,022, Del Mar Futurity [G1] (DMR, $150,000), San Vicente S. [G2] (SA, $90,000), Lazaro Bar - rera Memorial S. [G3] (BHP, $60,000), 2nd Norfolk S. [G1] (SA, $50,000), Northern Spur S. [L] (OP, $20,000), 3rd San Pasqual S. [G2] (SA, $24,- 000), Governor's Cup H. (BSR, $9,000), Big Bear S. (SA, $8,652). Well Lawyered (g. by Lawyer Ron).
    [Show full text]
  • Mating Analysis West Coast
    MATING ANALYSIS You may submit your mare online at lanesend.com or call 859-873-7300 to discuss your matings with CHANCE TIMM, [email protected], JILL MCCULLY, [email protected] or LEVANA CAPRIA, [email protected]. WEST COAST Flatter – Caressing by Honour and Glory 2014 Bay l 16.2 Hands “An Eclipse Award winning champion, West Coast is by an outstanding sire son of A.P. Indy, out of a ChampionTwo-Year-Old Filly. West Coast earned a title as Champion Three-Year-Old Colt with five consecutive victories, four in stakes events, and ran 1-2-3 in six consecutive grade one events, including when capturing the Travers Stakes (G1) and Pennsylvania Derby (G1). He is by Flatter, a leading stallion son of A.P. Indy, and sire of more than 50 stakes winners, and out of Caressing, Champion and Breeders’ Cup (G1) winner at two.“ The offspring of West Coast will be free of Northern Dancer at four generations on their sire’s side, and Flatter has crossed well with a wide variety of broodmare sires from that line. The cross with mares from the Danzig branch of Northern Dancer has been particulary productive with seven stakes winners, including graded stakes winners Classic Point and Mad Flatter out of mares by Langfuhr and Honor Grades (who gives inbreeding to the dam of A.P. Indy), and there are also stakes winners out of mares by War Front – who appears particularly interesting here, giving inbreeding to Relaunch and a full-sister – Danzig Connection, Ghazi and Military (who would be intriguing here).
    [Show full text]
  • BIRDSTONE B, 2001 Height 15.3 Dosage (7-8-9-0-2); DI: 3.00; CD: 0.69 See Gray Pages—Polynesian RACE and (STAKES) RECORD Fappiano, 1977 Mr
    BIRDSTONE b, 2001 height 15.3 Dosage (7-8-9-0-2); DI: 3.00; CD: 0.69 See gray pages—Polynesian RACE AND (STAKES) RECORD Fappiano, 1977 Mr. Prospector, by Raise a Native Age Starts 1st 2nd 3rd Earned 17s, SW, $370,213 2 3 2(1) 0 0 $339,000 Unbridled, 1987 410 f, 48 SW, 4.40 AEI Killaloe, by Dr. Fager 3 6 3(2) 0 0 $1,236,600 24s, SW, $4,489,475 566 f, 49 SW, 2.65 AEI Gana Facil, 1981 Le Fabuleux, by Wild Risk Totals 9 5(3) 0 0 $1,575,600 Grindstone, dkb/br, 1993 19s, wnr, $85,100 7 f, 6 r, 5 w, 2 SW Charedi, by In Reality Won At 2 6s, SW, $1,224,510 Champagne S (gr. I, $500,000, 8.5f in 1:44.05, by 554 f, 21 SW, 1.12 AEI Drone, 1966 Sir Gaylord, by Turn-to 2½, dftg. Chapel Royal, Dashboard Drummer, 7.38 AWD 4s, wnr, $12,825 Paddington, Notorious Rogue, Read the Footnotes, Buzz My Bell, 1981 592 f, 54 SW, 2.23 AEI Cap and Bells, by Tom Fool 13s, SW, $223,295 Midnight Express). 11 f, 10 r, 8 w, 3 SW Chateaupavia, 1966 Chateaugay, by Swaps A maiden special weight race at Sar ($45,000, 6f in 42s, wnr, $36,280 1:10.32, by 12½, dftg. Bold Love, Hornshope, etc.). 12 f, 11 r, 8 w, 1 SW Glenpavia, by Pavot Won At 3 Northern Dancer, 1961 Nearctic, by Nearco Belmont S (gr.
    [Show full text]
  • 138904 03 Dirtmile.Pdf
    breeders’ cup dirt mile BREEDERs’ Cup DIRT MILE (GR. I) 7th Running Santa Anita Park $1,000,000 Guaranteed FOR THREE-YEAR-OLDS AND UPWARD ONE MILE Northern Hemisphere Three-Year-Olds, 123 lbs.; Older, 126 lbs. Southern Hemisphere Three-Year-Olds, 120 lbs.; Older, 126 lbs. All Fillies and Mares allowed 3 lbs. Guaranteed $1 million purse including travel awards, of which 55% of all monies to the owner of the winner, 18% to second, 10% to third, 6% to fourth and 3% to fifth; plus travel awards to starters not based in California. The maximum number of starters for the Breeders’ Cup Dirt Mile will be limited to twelve (12). If more than twelve (12) horses pre-enter, selection will be determined by a combination of Breeders’ Cup Challenge Winners, Graded Stakes Dirt points and the Breeders’ Cup Racing Secretaries and Directors panel. Please refer to the 2013 Breeders’ Cup World Championships Horsemen’s Information Guide (available upon request) for more information. Nominated Horses Breeders’ Cup Racing Office Pre-Entry Fee: 1% of purse Santa Anita Park Entry Fee: 1% of purse 285 W. Huntington Dr. Arcadia, CA 91007 Phone: (859) 514-9422 To Be Run Friday, November 1, 2013 Fax: (859) 514-9432 Pre-Entries Close Monday, October 21, 2013 E-mail: [email protected] Pre-entries for the Breeders' Cup Dirt Mile (G1) Horse Owner Trainer Alpha Godolphin Racing, LLC Lessee Kiaran P. McLaughlin B.c.4 Bernardini - Munnaya by Nijinsky II - Bred in Kentucky by Darley Broadway Empire Randy Howg, Bob Butz, Fouad El Kardy & Rick Running Rabbit Robertino Diodoro B.g.3 Empire Maker - Broadway Hoofer by Belong to Me - Bred in Kentucky by Mercedes Stables LLC Brujo de Olleros (BRZ) Team Valor International & Richard Santulli Richard C.
    [Show full text]
  • Catálogo 2020 Haras San Pablo
    CATÁLOGO 2020 HARAS SAN PABLO 1 PERÚ En la Carátula y en esta página: TOFFEE, alazana nacida el 16 de Julio del 2016, hija de WESTOW (USA) y LICHA LICHA (USA), por MR. GREELEY (USA). Defendiendo los colores del Stud Black Label y entrenada por Juan Suárez Villarroel, ganó el Clásico Enrique Ayulo Pardo (G1) (foto carátula), Roberto Álvarez Calderón (L), Iniciación (R), Selectos - Potrancas (R) y Ala Moana (foto arriba). POTRANCA CAMPEONA DE 2 AÑOS y POTRANCA CAMPEONA DE 3 AÑOS el 2019 HARAS SAN PABLO (Fundado en 1979) PRODUCTOS FINA SANGRE DE CARRERA NACIDOS EN EL SEGUNDO SEMESTRE DE 2018 HIJOS DE: FLANDERS FIELDS (USA) KOKO MAMBO (PER-G1) MAN OF IRON (USA) MINISTER’S JOY (USA) YAZAMAAN (GB) Irrigación Santa Rosa Sayán - Lima, Perú 2020 INDICE Instrucciones para el uso de este catálogo ..................................................................................7 Plantel de Reproductores del Haras San Pablo - Padrillos y Yeguas Madres .....................12 Caballos CAMPEONES criados en el Haras San Pablo ..........................................................16 Clásicos GRUPO UNO, GRUPO DOS, GRUPO TRES ganados por el Haras San Pablo ..17 Productos ganadores de los Clásicos Selectos y Copa Criadores de la Asociación de Criadores de Caballos de Carrera del Perú ..............................................................................21 PADRILLOS EDITORIAL (USA), por War Front en Playa Maya por Arch ...............................................24 FLANDERS FIELDS (USA), por A.P. Indy en Flanders por Seeking the Gold .................28 KOKO MAMBO (PER), por Apprentice en Not For Sale por Mashhor Dancer ...............32 MAN OF IRON (USA), por Giant´s Causeway en Better Than Honour por Deputy Minister ...........36 MINISTER’S JOY (USA), por Deputy Minister en Meghan’s Joy por A.P.
    [Show full text]
  • BIRD SONG Gray Or Roan Colt; Foaled 2013 Fappiano Unbridled
    BIRD SONG Gray or Roan Colt; foaled 2013 Fappiano Unbridled .......................... Gana Facil Unbridled's Song .............. Caro (IRE) Trolley Song ...................... Lucky Spell BIRD SONG Seeking the Gold Cape Town ........................ Seaside Attraction Bird Town .......................... (2000) Storm Bird Dear Birdie ........................ Hush Dear By UNBRIDLED'S SONG (1993). Black-type winner of $1,311,800, Breeders' Cup Juvenile [G1] , etc. Sire of 17 crops of racing age, 1700 foals, 1321 starters, 115 black-type winners, 915 winners of 2728 races and earning $133,671,363, 4 champions, including Arrogate ($17,302,600, Pegasus World Cup Invitational S. [G1] (GP, $7,000,000)-ntr, etc.), Will Take Charge [G1] ($3,924,648), Midshipman [G1] ($1,584,600), and of Forever Unbri - dled [G1] ($2,086,880), Zensational [G1] ($669,300), Liam’s Map [G1] . 1st dam BIRD TOWN , by Cape Town. 4 wins at 2 and 3, $871,251, champion 3-year-old filly, Kentucky Oaks [G1] (CD, $355,756), Acorn S. [G1] (BEL, $150,000), Charon S. (GP, $31,260), 2nd Beldame S. [G1] (BEL, $150,000), Test S. [G1] (SAR, $50,000), Stonerside Beaumont S. [G2] (KEE, $50,000), 3rd Three Ring S. [L] (CRC, $11,000). Dam of 9 foals, 7 to race, 4 winners, including-- BIRD SONG (c. by Unbridled's Song). Black-type winner, below. Elusive Bird (f. by Elusive Quality). Unraced. Dam of 4 foals, 2 winners-- GORGEOUS BIRD (g. by Unbridled's Song). 4 wins, 2 to 4, placed at 5, 2017, $155,553, Don Bernhardt S. (ELP, $30,070). Pow Wow Wow (f. by Indian Charlie). Winner at 2, $92,845, 3rd Forward Gal S.
    [Show full text]
  • Stallion Synopsis For: Instagrand
    STALLION SYNOPSIS FOR: INSTAGRAND PREPARED BY: ALAN PORTER PREPARED FOR: PM ADVERTISING LLC Pedigree Consultants are able to help you in all facets of your thoroughbred investment. Not only are we able to proven mating advice but we are also able to advise on mare selection, management and promotion of stallions, and selection and purchase of racing and breeding stock. For more information on the services visit www.pedigreeconsultants.com, email [email protected] or call +1 859 285 0431. INSTAGRAND A $1,2,000,000 two-year-old in training purchase, Instagrand was a debut winner by 10 lengths going five furlongs in 56:00, and followed up with 10¼ lengths victory in the Best Pal Stakes (G2), demonstrating himself to be one of the most spectacular juvenile colts to represent the sensational Leading Sire, and twice Leading Sire of Two-Year-Olds, Into Mischief. Into Mischief has sired the brilliant Goldencents out of a mare by Banker’s Gold, and four stakes winners, including multiple grade one winner Practical Joke, out of mares by Distorted Humor (sire of Flower Alley, Sharp Humor, Drosselmeyer, Maclean’s Music and Jimmy Creed). Banker’s Gold and Distorted Humor are both sons of Forty Niner, a stallion who could also be introduced through mares by Coronado’s Quest, Editor’s Note, End Sweep, Jules, Luhuk, Gold Fever, Roar (broodmare sire of an Into Mischief stakes winner), Trippi (broodmare sire of an Into Mischief graded winner) and Twining. The Into Mischief cross with mares from the Gone West branch of Mr. Prospector has also been a very successful one.
    [Show full text]
  • Graydar Oxbow
    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
    [Show full text]
  • The Legacy of Mr. Prospector Lives on and Should Continue to Thrive
    Sire of sires: Mr. Prospector Dell Hancock photo The legacy of Mr. Prospector lives on and should continue to thrive thanks to the success of such top sons as Afleet, Forty Niner, and Kingmambo, along with grandsons Distorted Humor, Thunder Gulch, and Elusive Quality 14 A tree of many branches Grandson of the great Native Dancer has numerous male-line descendants at stud BY JOHN P. SPARKMAN Northern Dancer.) The male lines of Alydar, THE CURRENT level of influence Exclusive Native, *Sea-Bird, of Thoroughbred racing’s first and Sharpen Up all have faded television hero, Native Dancer, over time, but the line of Mr. could hardly have been predicted Prospector has thrived under at his death in 1967. Forty-three modern conditions and spread years on, there are more male- worldwide. line descendants of Native Dancer in the THOROUGHBRED TIMES Commercial star Stallion Directory, mostly through Bred in Kentucky by Leslie his grandson Mr. Prospector, than Combs II, Mr. Prospector was of any of his contemporaries. the second foal of Gold Digger, An undefeated two-year-old by Nashua, a very good race- champion in 1952, Native Dancer mare who was a great-grand- raced into the nation’s con- daughter of the Combs family’s sciousness in his only losing ef- great foundation mare fort, the 1953 Kentucky Derby. Myrtlewood, by Blue Larkspur. Short of work off a rushed prepa- Champion sprinter and cham- ration, he fell just a head short of Leonard photo Tony pion handicap mare of 1936, catching the classy front-runner Conquistador Cielo, who along with Fusaichi Pegasus ranks among Myrtlewood produced cham- Dark Star after encountering Mr.
    [Show full text]
  • Stallion Synopsis For: Not This Time Prepared By: Alan Porter Prepared For: Taylor Made Stallions
    STALLION SYNOPSIS FOR: NOT THIS TIME PREPARED BY: ALAN PORTER PREPARED FOR: TAYLOR MADE STALLIONS INC Pedigree Consultants are able to help you in all facets of your thoroughbred investment. Not only are we able to proven mating advice but we are also able to advise on mare selection, management and promotion of stallions, and selection and purchase of racing and breeding stock. For more information on the services visit www.pedigreeconsultants.com, email [email protected] or call +1 859 285 0431. NOT THIS TIME The most brilliant two-year-old son of sire of sires, Giant’s Causeway, Not This Time was also arguably the fastest and most spectacular two-year-old of his crop. In addition to being by Storm Cat’s leading sire son, he is out of record-breaking graded and multiple stakes winning Miss Macy Sue – also dam of brilliant Breeders’ Cup Mile (gr. I) victor Liam’s Map – and descends from Ta Wee, a two-time Champion Sprinter who is half-sister to the legendary Dr. Fager. Giant’s Causeway has demonstrated an affinity for the Fappiano branch of Mr. Prospector, and Fappiano is particularly interesting here, as he is out of a mare by Dr. Fager, which should work extremely well with remarkable strong Tartan Farm/Genter heritage in the dam of Not This Time (which includes inbreeding to Dr. Fager’s brilliant half-sister, Ta Wee). We can note that Unbridled’s Song – a grandson of Fappiano – is the sire of Not This Time’s brilliant half-brother Liam’s Map.
    [Show full text]
  • California Chrome
    CALIFORNIA CHROME A Horse of the Year and Champion Three-Year-Old, California Chrome is from the male-line of sire of sires Pulpit, and from the female line that has produce major sires Arch and Green Desert. His dam is inbred to a three-quarters sister and brother out of Champion Numbered Account, an outstanding runner and producer who is herself closely inbred to the family of La Troienne, the most important mare imported into the U.S. in the 20th century. Like two-time Champion Sire Tapit, California Chrome is a product of the Pulpit/Mr. Prospector cross, and he’s also bred on very similar lines to the dam of Super Saver. The Pulpit/Deputy Minister cross has produced such as grade one winners Tapizar and Frosted, and California’s Chrome’s sire has stakes winners out of mares by Deputy Minister sons Awesome Again (sire of Ghostzapper) and Dehere (whose son, Graeme Hall is also broodmare sire of a Pulpit line graded winner), and the Pulpit line has also worked over Deputy Minister through Silver Deputy and Touch G old (who should be a particularly good fit). Deputy Minister is a son of Northern Dancer, and the Storm Cat branch of that line has enjoyed exceptional success under Pulpit, with six grade one scorers. The cross has produced stakes winners out of mares by Forestry (whose son, Discreet Cat, would be very interesting); Giant’s Causeway and his brother, Freud; Tale of the Cat (who gives inbreeding to Pulpit’s family), Tabasco Cat (broodmare sire of two Pulpit line grade one winners), Hennessy (broodmare sire of two Pulpit line grade one winners, and sire of Johannesburg, who gives inbreeding to the family of Pulpit); Harlan’s Holiday, Menifee, and their sire Harlan; Forest Wildcat; Sir Cat (who is very clever here); and Catienus.
    [Show full text]