SLC23A2 (Human) Recombinant Protein (P01)

Total Page：16

File Type：pdf, Size：1020Kb

SLC23A2 (Human) Recombinant Protein (P01) Catalog # : H00009962-P01 規格 : [ 10 ug ] [ 25 ug ] List All Specification Application Image Product Human SLC23A2 full-length ORF ( AAH13112.1, 1 a.a. - 425 a.a.) Enzyme-linked Immunoabsorbent Assay Description: recombinant protein with GST-tag at N-terminal. Western Blot (Recombinant Sequence: MMGIGKNTTSKSMEAGSSTEGKYEDEAKHPAFFTLPVVINGGATSSGEQ protein) DNEDTELMAIYTTENGIAEKSSLAETLDSTGSLDPQRSDMIYTIEDVPPWY LCIFLGLQHYLTCFSGTIAVPFLLADAMCVGYDQWATSQLIGTIFFCVGIT Antibody Production TLLQTTFGCRLPLFQASAFAFLAPARAILSLDKWKCNTTDVSVANGTAEL LHTEHIWYPRIREIQGAIIMSSLIEVVIGLLGLPGALLKYIGPLTITPTVALIGL Protein Array SGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKFPLPIYKSKKGWTAY KLQLFKMFPIILAILVSWLLCFIFTVTDVFPPDSTKYGFYARTDARQGVLL VAPWFKVPYPFQWGLPTVSAAGVIGMLSAVVASIIESIGDYYACARLSCA PPPPIHAINRYVPEKTSS Host: Wheat Germ (in vitro) Theoretical MW 72.8 (kDa): Preparation in vitro wheat germ expression system Method: Purification: Glutathione Sepharose 4 Fast Flow Quality Control 12.5% SDS-PAGE Stained with Coomassie Blue. Testing: Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing. Instruction: Note: Best use within three months from the date of receipt of this protein. MSDS: Download Datasheet: Download Applications Enzyme-linked Immunoabsorbent Assay Page 1 of 2 2016/5/22 Western Blot (Recombinant protein) Antibody Production Protein Array Gene Information Entrez GeneID: 9962 GeneBank BC013112.2 Accession#: Protein AAH13112.1 Accession#: Gene Name: SLC23A2 Gene Alias: KIAA0238,NBTL1,SLC23A1,SVCT2,YSPL2 Gene solute carrier family 23 (nucleobase transporters), member 2 Description: Omim ID: 603791 Gene Ontology: Hyperlink Gene Summary: The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two required transporters and the encoded protein accounts for tissue-specific uptake of vitamin C. Previously, this gene had an official symbol of SLC23A1. [provided by RefSeq Other Na(+)/L-ascorbic acid transporter Designations: 2,OTTHUMP00000030173,OTTHUMP00000030174,sodium-dependent vitamin C transporter-2,solute carrier family 23 (nucleobase transporters), member 1,yolk sac permease-like molecule 2 Related Disease Adenocarcinoma Adenoma Colorectal Neoplasms Esophageal Neoplasms Genetic Predisposition to Disease Head and Neck Neoplasms Lung Neoplasms Lymphoma, Non-Hodgkin Ovarian cancer Papillomavirus Infections Premature Birth Pulmonary Disease, Chronic Obstructive Stomach Neoplasms Tobacco Use Disorder Urinary Bladder Neoplasms Werner syndrome 服務條款 | 隱私權政策 | 著作及商標 | 網站地圖 ©2016 亞諾法生技股份有限公司 Abnova Corporation. 版權所有. Page 2 of 2 2016/5/22.

Copy Link

Recommended publications

A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
[Show full text]
Chloride Channels Regulate Differentiation and Barrier Functions
RESEARCH ARTICLE Chloride channels regulate differentiation and barrier functions of the mammalian airway Mu He1†*, Bing Wu2†, Wenlei Ye1, Daniel D Le2, Adriane W Sinclair3,4, Valeria Padovano5, Yuzhang Chen6, Ke-Xin Li1, Rene Sit2, Michelle Tan2, Michael J Caplan5, Norma Neff2, Yuh Nung Jan1,7,8, Spyros Darmanis2*, Lily Yeh Jan1,7,8* 1Department of Physiology, University of California, San Francisco, San Francisco, United States; 2Chan Zuckerberg Biohub, San Francisco, United States; 3Department of Urology, University of California, San Francisco, San Francisco, United States; 4Division of Pediatric Urology, University of California, San Francisco, Benioff Children’s Hospital, San Francisco, United States; 5Department of Cellular and Molecular Physiology, Yale University School of Medicine, New Heaven, United States; 6Department of Anesthesia and Perioperative Care, University of California, San Francisco, San Francisco, United States; 7Department of Biochemistry and Biophysics, University of California, San Francisco, San Francisco, United States; 8Howard Hughes Medical Institute, University of California, San Francisco, San Francisco, United States *For correspondence: Abstract The conducting airway forms a protective mucosal barrier and is the primary target of [email protected] (MH); [email protected] airway disorders. The molecular events required for the formation and function of the airway (SD); mucosal barrier, as well as the mechanisms by which barrier dysfunction leads to early onset airway [email protected] (LYJ) diseases,
[Show full text]
Diagnosis of Metastatic Melanoma and Monitoring Indicators of Immunosuppression Through Blood Leukocyte Microarray Analysis
(19) TZZ __T (11) EP 2 579 174 A1 (12) EUROPEAN PATENT APPLICATION (43) Date of publication: (51) Int Cl.: 10.04.2013 Bulletin 2013/15 G06F 19/00 (2011.01) (21) Application number: 12196231.0 (22) Date of filing: 03.11.2007 (84) Designated Contracting States: • Banchereau, Jacques F. AT BE BG CH CY CZ DE DK EE ES FI FR GB GR Montclair, NJ 07042 (US) HU IE IS IT LI LT LU LV MC MT NL PL PT RO SE • Chaussabel, Damien SI SK TR Bainbridge Island, WA 98110 (US) (30) Priority: 03.11.2006 US 856406 P (74) Representative: Sonn & Partner Patentanwälte Riemergasse 14 (62) Document number(s) of the earlier application(s) in 1010 Wien (AT) accordance with Art. 76 EPC: 07871360.9 / 2 080 140 Remarks: This application was filed on 10-12-2012 as a (71) Applicant: Baylor Research Institute divisional application to the application mentioned Dallas, TX 75204 (US) under INID code 62. (72) Inventors: • Palucka, Anna Karolina Dallas, TX 75204 (US) (54) Diagnosis of metastatic melanoma and monitoring indicators of immunosuppression through blood leukocyte microarray analysis (57) The present invention includes compositions, or more expression vectors from the expression of one systems and methods for the early detection and con- or more genes. sistent determination of metastatic melanoma and/or im- munosuppression using microarrays by calculating one EP 2 579 174 A1 Printed by Jouve, 75001 PARIS (FR) EP 2 579 174 A1 Description TECHNICAL FIELD OF THE INVENTION 5 [0001] The presentinvention relates in generalto the field of diagnostic for monitoring indicatorsof metastatic melanoma and/or immunosuppression, and more particularly, to a system, method and apparatus for the diagnosis, prognosis and tracking of metastatic melanoma and monitoring indicators of immunosuppression associated with transplant recipients (e.g., liver).
[Show full text]
Mycobacterium Tuberculosis Mce1 Protein Complex Initiates Rapid Induction of Transcription of Genes Involved in Substrate Trafficking
Genes and Immunity (2012) 13, 496–502 & 2012 Macmillan Publishers Limited All rights reserved 1466-4879/12 www.nature.com/gene ORIGINAL ARTICLE Mycobacterium tuberculosis Mce1 protein complex initiates rapid induction of transcription of genes involved in substrate trafficking R Stavrum1, H Valvatne1,8, A-K Stavrum2,3, LW Riley4, E Ulvestad5, I Jonassen3,6, TM Doherty7,9 and HMS Grewal1,5 The mammalian cell entry (Mce)1 protein complex has an important role during the initial phase of a Mycobacterium tuberculosis (M. tuberculosis) infection. Murine macrophages were infected with M. tuberculosis H37Rv or D-mce1 H37Rv, and total RNA was isolated from the host cells at 15, 30 and 60 min, and 4 and 10 h post-infection. With the aim of studying the role for the Mce1 protein complex on host gene expression, the RNA was hybridized onto 44 K whole-genome microarrays. Selected genes were verified by reverse-transcriptase quantitative PCR (RT-QPCR). ‘Transport’ was the most overrepresented biological process during the first hour post H37Rv infection. Five genes (Abca1 (21.0-fold), Slc16a10 (3.1-fold), Slc6a12 (17.9-fold), Slc6a8 (2.3-fold) and Nr1h3, (5.5-fold)) involved in substrate trafficking were verified by RT-QPCR to be upregulated by 42-fold 1 h post H37Rv infection. By 1 h post D-mce1 H37Rv infection, only Abca1 and Slc6a12 were upregulated by 42-fold. A number of other genes, which may be directly involved in substrate trafficking or share the same transcription, were found to have expression profiles similar to the genes involved in substrate trafficking.
[Show full text]
Frontiersin.Org 1 April 2015 | Volume 9 | Article 123 Saunders Et Al
ORIGINAL RESEARCH published: 28 April 2015 doi: 10.3389/fnins.2015.00123 Influx mechanisms in the embryonic and adult rat choroid plexus: a transcriptome study Norman R. Saunders 1*, Katarzyna M. Dziegielewska 1, Kjeld Møllgård 2, Mark D. Habgood 1, Matthew J. Wakefield 3, Helen Lindsay 4, Nathalie Stratzielle 5, Jean-Francois Ghersi-Egea 5 and Shane A. Liddelow 1, 6 1 Department of Pharmacology and Therapeutics, University of Melbourne, Parkville, VIC, Australia, 2 Department of Cellular and Molecular Medicine, University of Copenhagen, Copenhagen, Denmark, 3 Walter and Eliza Hall Institute of Medical Research, Parkville, VIC, Australia, 4 Institute of Molecular Life Sciences, University of Zurich, Zurich, Switzerland, 5 Lyon Neuroscience Research Center, INSERM U1028, Centre National de la Recherche Scientifique UMR5292, Université Lyon 1, Lyon, France, 6 Department of Neurobiology, Stanford University, Stanford, CA, USA The transcriptome of embryonic and adult rat lateral ventricular choroid plexus, using a combination of RNA-Sequencing and microarray data, was analyzed by functional groups of influx transporters, particularly solute carrier (SLC) transporters. RNA-Seq Edited by: Joana A. Palha, was performed at embryonic day (E) 15 and adult with additional data obtained at University of Minho, Portugal intermediate ages from microarray analysis. The largest represented functional group Reviewed by: in the embryo was amino acid transporters (twelve) with expression levels 2–98 times Fernanda Marques, University of Minho, Portugal greater than in the adult. In contrast, in the adult only six amino acid transporters Hanspeter Herzel, were up-regulated compared to the embryo and at more modest enrichment levels Humboldt University, Germany (<5-fold enrichment above E15).
[Show full text]
Ascorbic Acid and the Brain: Rationale for the Use Against Cognitive Decline
Nutrients 2014, 6, 1752-1781; doi:10.3390/nu6041752 OPEN ACCESS nutrients ISSN 2072-6643 www.mdpi.com/journal/nutrients Review Ascorbic Acid and the Brain: Rationale for the Use against Cognitive Decline Fiona E. Harrison 1, Gene L. Bowman 2 and Maria Cristina Polidori 3,* 1 Division of Diabetes, Endocrinology and Metabolism, Department of Medicine, Vanderbilt University Medical Center, Nashville, TN 37232, USA; E-Mail: [email protected] 2 Brain Institute, Department of Neurology, NIA–Aging and Alzheimer’s Disease Center Oregon Health and Science University, Portland, OR 97239, USA; E-Mail: [email protected] 3 Geriatrics Department, University of Cologne Medical Faculty, Cologne 50937, Germany * Author to whom correspondence should be addressed; E-Mail: [email protected]; Tel.: +49-221-4788-6704; Fax: +49-221-4788-6710. Received: 25 October 2013; in revised form: 24 March 2014 / Accepted: 10 April 2014 / Published: 24 April 2014 Abstract: This review is focused upon the role of ascorbic acid (AA, vitamin C) in the promotion of healthy brain aging. Particular attention is attributed to the biochemistry and neuronal metabolism interface, transport across tissues, animal models that are useful for this area of research, and the human studies that implicate AA in the continuum between normal cognitive aging and age-related cognitive decline up to Alzheimer’s disease. Vascular risk factors and comorbidity relationships with cognitive decline and AA are discussed to facilitate strategies for advancing AA research in the area of brain health and neurodegeneration. Keywords: ascorbic acid; Vitamin C; brain; cognitive function; alzheimer’s disease; dementia; aging; elderly; endothelial function; blood-brain barrier; SVCT (Sodium-dependent vitamin C transporter) 1.
[Show full text]
Supporting Information
Supporting Information Table S1. List of confirmed SLC transporters represented in Canine GeneChip. SLC family Members detected Members not detected SLC1: The high affinity glutamate and neutral amino acid SLC1A1 SLC1A2, SLC1A3, SLC1A6 transporter family SLC2: The facilitative GLUT transporter family SLC2A1, SLC2A8 SLC2A3, SLC2A9 SLC3: The heavy subunits of the heteromeric amino acid SLC3A1 transporters SLC4: The bicarbonate transporter family SLC4A11 SLC4A4, SLC4A8 SLC5: The sodium glucose cotransporter family SLC5A6 SLC5A3, SLC5A10, SLC5A12 SLC6: The sodium- and chloride- dependent SLC6A6, SLC6A12 SLCA18 neurotransmitter transporter family SLC7: The cationic amino acid transporter/glycoprotein- NR associated family SLC8: The Na+/Ca2+ exchanger family SLC8A1 SLC9: The Na+/H+ exchanger family SLC9A1, SLC9A6, SLC9A9 SLC10: The sodium bile salt cotransport family SLC10A2 SLC11: The proton coupled metal ion transporter family NR SLC12: The electroneutral cation-Cl cotransporter family SLC12A3, SLC12A6, SLC12A8 SLC13: The human Na+-sulfate/carboxylate cotransporter SLC13A2 family SLC14: The urea transporter family NR SLC15: The proton oligopeptide cotransporter family SLC15A2, SLC15A4 SLC15A1 SLC16: The monocarboxylate transporter family SLC16A13 SLC16A4 SLC17: The vesicular glutamate transporter family SLC17A3, SLC17A7 SLC18: The vesicular amine transporter family NR SLC19: The folate/thiamine transporter family NR SLC20: The type III Na+-phosphate cotransporter family NR SLC21/SLCO: The organic anion transporting family SLC21A3, SLC21A8,
[Show full text]
Sodium-Coupled Glucose Transport, the SLC5 Family, and Therapeutically Relevant Inhibitors: from Molecular Discovery to Clinical Application
Pflügers Archiv - European Journal of Physiology (2020) 472:1177–1206 https://doi.org/10.1007/s00424-020-02433-x INVITED REVIEW Sodium-coupled glucose transport, the SLC5 family, and therapeutically relevant inhibitors: from molecular discovery to clinical application Gergely Gyimesi1 & Jonai Pujol-Giménez1 & Yoshikatsu Kanai2 & Matthias A. Hediger1 Received: 4 March 2020 /Revised: 24 June 2020 /Accepted: 2 July 2020 / Published online: 7 August 2020 # The Author(s) 2020 Abstract Sodium glucose transporters (SGLTs) belong to the mammalian solute carrier family SLC5. This family includes 12 different members in human that mediate the transport of sugars, vitamins, amino acids, or smaller organic ions such as choline. The SLC5 family belongs to the sodium symporter family (SSS), which encompasses transporters from all kingdoms of life. It furthermore shares similarity to the structural fold of the APC (amino acid-polyamine-organocation) transporter family. Three decades after the first molecular identification of the intestinal Na+-glucose cotransporter SGLT1 by expression cloning, many new discoveries have evolved, from mechanistic analysis to molecular genetics, structural biology, drug discovery, and clinical applications. All of these advances have greatly influenced physiology and medicine. While SGLT1 is essential for fast absorption of glucose and galactose in the intestine, the expression of SGLT2 is largely confined to the early part of the kidney proximal tubules, where it reabsorbs the bulk part of filtered glucose. SGLT2 has been successfully exploited by the pharmaceutical industry to develop effective new drugs for the treatment of diabetic patients. These SGLT2 inhibitors, termed gliflozins, also exhibit favorable nephroprotective effects and likely also cardioprotective effects.
[Show full text]
Oxidized Phospholipids Regulate Amino Acid Metabolism Through MTHFD2 to Facilitate Nucleotide Release in Endothelial Cells
ARTICLE DOI: 10.1038/s41467-018-04602-0 OPEN Oxidized phospholipids regulate amino acid metabolism through MTHFD2 to facilitate nucleotide release in endothelial cells Juliane Hitzel1,2, Eunjee Lee3,4, Yi Zhang 3,5,Soﬁa Iris Bibli2,6, Xiaogang Li7, Sven Zukunft 2,6, Beatrice Pﬂüger1,2, Jiong Hu2,6, Christoph Schürmann1,2, Andrea Estefania Vasconez1,2, James A. Oo1,2, Adelheid Kratzer8,9, Sandeep Kumar 10, Flávia Rezende1,2, Ivana Josipovic1,2, Dominique Thomas11, Hector Giral8,9, Yannick Schreiber12, Gerd Geisslinger11,12, Christian Fork1,2, Xia Yang13, Fragiska Sigala14, Casey E. Romanoski15, Jens Kroll7, Hanjoong Jo 10, Ulf Landmesser8,9,16, Aldons J. Lusis17, 1234567890():,; Dmitry Namgaladze18, Ingrid Fleming2,6, Matthias S. Leisegang1,2, Jun Zhu 3,4 & Ralf P. Brandes1,2 Oxidized phospholipids (oxPAPC) induce endothelial dysfunction and atherosclerosis. Here we show that oxPAPC induce a gene network regulating serine-glycine metabolism with the mitochondrial methylenetetrahydrofolate dehydrogenase/cyclohydrolase (MTHFD2) as a cau- sal regulator using integrative network modeling and Bayesian network analysis in human aortic endothelial cells. The cluster is activated in human plaque material and by atherogenic lipo- proteins isolated from plasma of patients with coronary artery disease (CAD). Single nucleotide polymorphisms (SNPs) within the MTHFD2-controlled cluster associate with CAD. The MTHFD2-controlled cluster redirects metabolism to glycine synthesis to replenish purine nucleotides. Since endothelial cells secrete purines in response to oxPAPC, the MTHFD2- controlled response maintains endothelial ATP. Accordingly, MTHFD2-dependent glycine synthesis is a prerequisite for angiogenesis. Thus, we propose that endothelial cells undergo MTHFD2-mediated reprogramming toward serine-glycine and mitochondrial one-carbon metabolism to compensate for the loss of ATP in response to oxPAPC during atherosclerosis.
[Show full text]
(B6;129.Cg-Gt(ROSA)26Sor Tm20(CAG-Ctgf-GFP)Jsd) Were Crossed with Female Foxd1cre/+ Heterozygote Mice 1, and Experimental Mice Were Selected As Foxd1cre/+; Rs26cig/+
Supplemental Information SI Methods Animal studies Heterozygote mice (B6;129.Cg-Gt(ROSA)26Sor tm20(CAG-Ctgf-GFP)Jsd) were crossed with female Foxd1Cre/+ heterozygote mice 1, and experimental mice were selected as Foxd1Cre/+; Rs26CIG/+. In some studies Coll-GFPTg or TCF/Lef:H2B-GFPTg mice or Foxd1Cre/+; Rs26tdTomatoR/+ mice were used as described 2; 3. Left kidneys were subjected to ureteral obstruction using a posterior surgical approach as described 2. In some experiments recombinant mouse DKK1 (0.5mg/kg) or an equal volume of vehicle was administered by daily IP injection. In the in vivo ASO experiment, either specific Lrp6 (TACCTCAATGCGATTT) or scrambled negative control ASO (AACACGTCTATACGC) (30mg/kg) (Exiqon, LNA gapmers) was administered by IP injection on d-1, d1, d4, and d7. In other experiments anti-CTGF domain-IV antibodies (5mg/kg) or control IgG were administered d-1, d1 and d6. All animal experiments were performed under approved IACUC protocols held at the University of Washington and Biogen. Recombinant protein and antibody generation and characterization Human CTGF domain I (sequence Met1 CPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFC), domain I+II (sequence Met1CPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFCCIFGGT VYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEE) were cloned and expressed in 293 cells, and purified by Chelating SFF(Ni) Column, tested for single band by SEC and PAGE, and tested for absence of contamination. Domain-IV (sequence GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGE VMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMY) was purchased from Peprotech. Mouse or human DKK1 was generated from the coding sequence with some modifications and a tag. Secreted protein was harvested from 293 cells, and purified by nickel column, and tested for activity in a supertopflash (STF) assay 4. DKK1 showed EC50 of 0.69nM for WNT3a-induced WNT signaling in STF cells.
[Show full text]
Expression of Intestinal Transporter Genes in Beagle Dogs
308 EXPERIMENTAL AND THERAPEUTIC MEDICINE 5: 308-314, 2013 Expression of intestinal transporter genes in beagle dogs SOO-MIN CHO1*, SUNG-WON PARK1,2*, NA‑HYUN KIM1, JIN-A PARK1, HEE YI1, HEE-JUNG CHO1, KI-HWAN PARK3, INGYUN HWANG4 and HO-CHUL SHIN1 1Department of Veterinary Pharmacology and Toxicology, College of Veterinary Medicine, Konkuk University, Seoul 143‑701; 2Toxicology and Chemistry Division, Animal Plant and Fisheries Quarantine and Inspection Agency, Anyang 430‑824; 3Department of Food Science & Technology, Chung‑Ang University, Ansung 456‑756; 4Food Chemical Residues Division, Korea Food & Drug Administration, Osong 363-951, Republic of Korea Received August 8, 2012; Accepted October 12, 2012 DOI: 10.3892/etm.2012.777 Abstract. This study was performed to produce a transcrip- 5% of all human genes are associated with transporters which tional database of the intestinal transporters of beagle dogs. is consistent with the biological significance of transporters Total RNA was isolated from the duodenum and the expres- and their roles in cell homeostasis. The identification and sion of various mRNAs was measured using GeneChip® characterization of drug transporters has provided a scientific oligonucleotide arrays. A total of 124 transporter genes were basis for understanding drug delivery and disposition, the detected. Genes for fatty acid, peptide, amino acid and glucose molecular mechanisms of drug interactions and inter‑indi- and multidrug resistance/multidrug resistance-associated vidual/inter‑species differences (3). Various types of xenobiotic protein (MDR/MRP) transport were expressed at relatively or drug transporters have been identified as being important higher levels than the other transporter types. The dogs exhib- as barriers against toxic compounds and influx pumps to take ited abundant mRNA expression of the fatty acid transporters up nutrients into the body.
[Show full text]
RNA-Seq Reveals Conservation of Function Among the Yolk Sacs Of
RNA-seq reveals conservation of function among the PNAS PLUS yolk sacs of human, mouse, and chicken Tereza Cindrova-Daviesa, Eric Jauniauxb, Michael G. Elliota,c, Sungsam Gongd,e, Graham J. Burtona,1, and D. Stephen Charnock-Jonesa,d,e,1,2 aCentre for Trophoblast Research, Department of Physiology, Development and Neuroscience, University of Cambridge, Cambridge, CB2 3EG, United Kingdom; bElizabeth Garret Anderson Institute for Women’s Health, Faculty of Population Health Sciences, University College London, London, WC1E 6BT, United Kingdom; cSt. John’s College, University of Cambridge, Cambridge, CB2 1TP, United Kingdom; dDepartment of Obstetrics and Gynaecology, University of Cambridge, Cambridge, CB2 0SW, United Kingdom; and eNational Institute for Health Research, Cambridge Comprehensive Biomedical Research Centre, Cambridge, CB2 0QQ, United Kingdom Edited by R. Michael Roberts, University of Missouri-Columbia, Columbia, MO, and approved May 5, 2017 (received for review February 14, 2017) The yolk sac is phylogenetically the oldest of the extraembryonic yolk sac plays a critical role during organogenesis (3–5, 8–10), membranes. The human embryo retains a yolk sac, which goes there are limited data to support this claim. Obtaining experi- through primary and secondary phases of development, but its mental data for the human is impossible for ethical reasons, and importance is controversial. Although it is known to synthesize thus we adopted an alternative strategy. Here, we report RNA proteins, its transport functions are widely considered vestigial. sequencing (RNA-seq) data derived from human and murine yolk Here, we report RNA-sequencing (RNA-seq) data for the human sacs and compare them with published data from the yolk sac of and murine yolk sacs and compare those data with data for the the chicken.
[Show full text]