DOCSLIB.ORG

Supplementary Figure 1: Specificity of Anti-TIGIT Antibody 1G9. TIGIT-Specific Antibodies Were Generated in TIGIT-/- Mice (Clone 1G9)

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Supplementary Figure 1: Specificity of Anti-TIGIT Antibody 1G9. TIGIT-Specific Antibodies Were Generated in TIGIT-/- Mice (Clone 1G9) Supplementary Figure 1: Specificity of anti-TIGIT antibody 1G9. TIGIT-specific antibodies were generated in TIGIT-/- mice (clone 1G9). (A) 1G9 was titrated in an ELISA against recombinant mouse TIGIT or a control protein. (B) Anti-TIGIT antibody 1G9 was used to stain P815 cells transfected with mouse TIGIT (solid line) or the parental untransfected cell line as control (shaded histogram) and samples were analyzed by flow cytometry. (C) Primary T cells from B6 or TIGIT-/- mice were activated for 48h and stained using anti-TIGIT antibody 1G9 (solid line) or an isotype control (shaded histogram) and analyzed by flow cytometry. Samples are gated on the CD4+ population. Representative examples of 5 (A) or over 10 (B and C) independent experiments are shown. Supplementary Figure 2: TIGIT acts on APCs and on T cells. (A) CD4+ T cells were isolated and labeled with CFSE. Wild type B6 or TIGIT-/- CD4+ T cells were stimulated with anti-CD3 in the presence of irradiated APCs from wild type B6 or TIGIT-/- mice. Proliferation was analyzed after 60h using flow cytometry. (B) CD45.1 B6 recipients received 105 CD62L+CD4+ 2D2 or 2D2 x TIGIT-/- cells i.v. one day before s.c. immunization with 100μg MOG35-55 peptide in CFA. On day 7 spleens and lymph nodes (LN) were harvested and frequencies and absolute numbers of transferred CD45.2+ T cells were determined by flow cytometry (B; n=4). (C-E) TIGIT-specific antibodies were generated in Armenian hamsters (clone 4D4). (C) 4D4 was titrated in an ELISA against recombinant mouse TIGIT or a control protein. (D) P815 cells transfected with mouse TIGIT (solid line) or the parental cell line (shaded histogram) were stained with anti- TIGIT antibodies and analyzed by flow cytometry. (E) Primary T cells from B6 or TIGIT-/- mice were activated for 48h and stained with anti-TIGIT antibody 4D4 (solid line) or isotype control (shaded histogram) and analyzed by flow cytometry (gated on CD4+ cells). Supplementary Figure 3: TCR activation and survival pathways are differentially activated upon TIGIT engagement. Expression values of all analyzed genes (A) or genes contained in the TCR activation (B) and T cell survival (C) gene sets are displayed. Normalized log2 expression values in wild type CD4+ T cells treated with agonistic anti- TIGIT (B6 4D4) are plotted against the mean of the isotype and TIGIT-/- controls (controls). Plots were produced in the statistical environment R (http://www.r- project.org/). Molecules driving the association are marked in red and their names are given. Overall, the T cell survival gene set shows higher expression in the B6 4D4 sample (most genes are on the right side of the diagonal), while the T cell activation molecules are expressed to a higher extent in the control samples (more genes on the left side of the diagonal line). Supplementary Figure 4: Signaling pathways downstream of TIGIT. (A and B) Expression of genes involved in the TCR activation (A) and T cell survival (B) were differentially expressed in wild type CD4+ T cells stimulated with agonistic anti-TIGIT antibody compared to the controls (isotype and TIGIT-/- controls). Molecules are represented as nodes (see legend for different shapes), and the biological relationships between different nodes are indicated. The node color indicates if a gene is up- (green) or down- (red) regulated (p-value smaller or equal to 0.1, and fold change greater or equal to 2 1.2, or smaller or equal to 0.8 was regarded as significant). Complexes formed by molecules that were both up- and down-regulated are shaded in red and green. White nodes represent molecules that are not part of the data set. Figures generated within Ingenuity. (C and D) CD4+ T cells were sorted from B6 and TIGIT-/- mice and stimulated with plate-bound anti-CD3 and anti-CD28 plus 4D4 or isotype control Ab. After 24h RNA was isolated and expression of genes involved in TCR activation (C) or T cell survival (D) was assessed by quantitative RT-PCR (triplicate wells, one of three experiments). 3 100 100 100 80 80 80 60 60 60 % of Max % of Max % of Max 40 40 40 20 20 20 0 0 0 100 101 102 103 104 100 101 102 103 104 100 101 102 103 104 ! 100 40! 80! 30! 60! 20! 40! 10! 20! 0! 0! ! 3! 4! 5! ! 3! 4! 5! 2 0!102! 10! 10! 10! 0!10! 10! 10! 10! 800 600 600 400 400 # Cells 200 200 0 0 100 101 102 103 104 100 101 102 103 104 FL1-H: CFSE 1000 800 800 600 600 # Cells # Cells 400 400 200 200 0 0 100 101 102 103 104 100 101 102 103 104 100 100 100 100 100 " 80 80 80 80 80 60 60 60 60 60 % of Max % of Max 40 40 % of Max % of Max % of Max 40 40 40 20 20 20 20 20 0 0 0102 103 104 105 0102 103 104 105 0 0 0 0 1 2 3 4 100 101 102 103 104 10 10 10 10 10 100 101 102 103 104 FL2-H FL2-H FL2-H ! A 14 12 10 8 controls 6 4 2 2 4 6 8 10 12 14 B6 4D4 stimulated B log(Expression) of T-cell activation genes in B6 4D4 vs. controls Ptprc 12 Actr3 Cd3d Actr3 Cd3g Lat Cd28 10 Cd247 Cdc42 Lcp2 Rasgrp1 Zap70 Pdk1Cd3e Nfatc3 8 Fyn Grb2Ctla4 Cdk2 Mapk1 Ccna2 NrasNfatc1 Sos2Ralbp1 controls Pic3ca Malt1Cd28 Nfatc1 Relb Grb2 Vav1 6 Pic3ca Map3k1 Lcp2 Vav2 Vav3 Nfat5 Mapk8 Fadd Nfatc1Pik3r1 Card11 4 Rasgrp1 Rras Ppp3ca Mapk8 Pik3cb Mapk1 Cdk6 Pik3cg 4 6 8 10 12 B6 4D4 C log(Expression) of T-cell survival genes in B6 4D4 vs. controls 10 Myc Nfkb1 Rac2 Bax Rac1 8 Mcl1 Rela Jun Il2ra controls Rel Bcl-XL 6 Il7r Relb Casp7 Fos Bad Nfkb2 Stat5a Jak1 4 Il2rb Akt3 Il15ra Jak3 Il7r Il15ra Bcl-XL Map3k8 Mdk Casp9 4 6 8 10 B6 4D4 = ! ! ! ! ! ! Supplementary Table I fold change fold change (B6 4D4 vs. (B6 4D4 vs. Name Affimetrix ID controls) p-value Name Affimetrix ID controls) p-value Luc7l2 1436767_at -2.548 0.023 Amigo2 1434601_at 1.793 0.023 Nfil3 1418932_at -2.081 0.042 Elf2 1428045_a_at 1.786 0.007 Ttc39b 1452009_at -1.996 0.047 RIKEN cDNA 4930513F16 1429874_at 1.730 0.014 Pura 1436844_at -1.858 0.030 Il7r 1448576_at 1.730 0.002 Slc25a24 1452717_at -1.856 0.049 Ccdc21 1432391_at 1.723 0.007 Araf 1440764_at -1.828 0.013 Zfp653 1435481_at 1.706 0.001 1441233_at -1.803 0.040 Pik3ip1 1428332_at 1.647 0.040 Arl6 1417331_a_at -1.738 0.028 Eif3s6i 1455811_at 1.640 0.003 Nktr 1437660_at -1.727 0.001 Glt25d1 1433496_at 1.634 0.001 Rbpj 1418114_at -1.671 0.050 Trmt1 1437314_a_at 1.603 0.040 Zfp826 1428748_at -1.657 0.035 LOC433762 1431213_a_at 1.596 0.030 Wdr41 1433620_at -1.640 0.002 Il7r 1448575_at 1.586 0.024 Cetn4 1436617_at -1.638 0.028 RIKEN cDNA 1810044D09 1441871_at 1.577 0.025 Hibch 1451511_at -1.632 0.034 Gclm 1439050_at 1.555 0.045 Hells 1453361_at -1.623 0.032 Acy1 1419173_at 1.536 0.031 Ar 1455647_at -1.621 0.017 Gramd3 1428737_s_at 1.515 0.019 1456864_at -1.609 0.017 Eif2ak2 1422005_at 1.486 0.002 Lyst 1434674_at -1.608 0.023 Sec22a 1416320_at 1.485 0.002 Zfp799 1437873_at -1.582 0.007 Immt 1429533_at 1.477 0.001 Ddx6 1447789_x_at -1.547 0.014 RIKEN cDNA 5830468F06 1432288_at 1.476 0.009 Mnt 1449661_at -1.547 0.016 Naa35 1453263_at 1.473 0.028 Ptk2 1423059_at -1.546 0.020 RIKEN cDNA 2810408M09 1452931_at 1.470 0.044 Idh3a 1422500_at -1.540 0.029 Ifit3 1449025_at 1.470 0.036 Samd8 1434402_at -1.539 0.027 Polrmt 1452835_a_at 1.466 0.036 Fbxo45 1428742_at -1.531 0.013 Ly6e 1439773_at 1.451 0.012 Rpl27a 1437729_at -1.529 0.056 RIKEN cDNA 2900018N21 1432824_at 1.450 0.000 Tpp2 1421893_a_at -1.528 0.009 Nfkbiz 1457404_at 1.442 0.050 Cul4a 1426060_at -1.522 0.174 H2-Ob 1422201_at 1.440 0.000 RIKEN cDNA E330009D23 1443779_s_at -1.520 0.008 Abcg1 1423570_at 1.438 0.034 Kctd20 1416323_at -1.517 0.010 Epm2aip1 1434106_at 1.432 0.199 Scai 1456357_at -1.516 0.010 Magt1 1419459_a_at 1.431 0.029 Rc3h2 1438268_at -1.516 0.028 Irf8 1448452_at 1.429 0.025 B3gnt2 1420852_a_at -1.507 0.023 Fabp1 1448764_a_at 1.409 0.001 Apc 1435543_at -1.506 0.006 Dpm1 1419353_at 1.404 0.000 RIKEN cDNA 4921513D23 1445862_at -1.500 0.000 Zfp398 1439979_at -1.490 0.018 Tbl1xr1 1450739_at -1.486 0.007 Fam33a 1437480_at -1.482 0.001 Strn3 1441266_at -1.481 0.005 Hipk2 1424863_a_at -1.475 0.035 RICKEN cDNA E130012A19 1426980_s_at -1.474 0.004 Nfat5 1439805_at -1.473 0.024 Zmym3 1455017_a_at -1.472 0.043 Hipk2 1428433_at -1.471 0.003 NA 1457053_at -1.466 0.066 NA 1458718_at -1.465 0.037 Arl13b 1437021_at -1.460 0.002 Zfp191 1430651_s_at -1.457 0.001 Vps41 1437901_a_at -1.457 0.033 RIKEN cDNA 2210018M11 1430028_at -1.455 0.011 Sacs 1434958_at -1.442 0.046 Ralgapa1 1428594_at -1.441 0.016 RIKEN cDNA E230008J23 1439571_at -1.435 0.002 Fam149b 1435686_at -1.434 0.008 Phf3 1428999_at -1.433 0.047 Strada 1428188_at -1.433 0.031 Nudt6 1456945_at -1.422 0.007 1439169_at -1.420 0.000 RIKEN cDNA C230085N15 1457656_s_at -1.420 0.036 Ms4a4d 1418990_at -1.420 0.006 Vps37a 1419177_at -1.406 0.005 C1d 1416886_at -1.404 0.007 Nnt 1456573_x_at -1.404 0.002 .
Load more

Recommended publications
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Supplementary File 2A Revised
    Supplementary file 2A. Differentially expressed genes in aldosteronomas compared to all other samples, ranked according to statistical significance. Missing values were not allowed in aldosteronomas, but to a maximum of five in the other samples. Acc UGCluster Name Symbol log Fold Change P - Value Adj. P-Value B R99527 Hs.8162 Hypothetical protein MGC39372 MGC39372 2,17 6,3E-09 5,1E-05 10,2 AA398335 Hs.10414 Kelch domain containing 8A KLHDC8A 2,26 1,2E-08 5,1E-05 9,56 AA441933 Hs.519075 Leiomodin 1 (smooth muscle) LMOD1 2,33 1,3E-08 5,1E-05 9,54 AA630120 Hs.78781 Vascular endothelial growth factor B VEGFB 1,24 1,1E-07 2,9E-04 7,59 R07846 Data not found 3,71 1,2E-07 2,9E-04 7,49 W92795 Hs.434386 Hypothetical protein LOC201229 LOC201229 1,55 2,0E-07 4,0E-04 7,03 AA454564 Hs.323396 Family with sequence similarity 54, member B FAM54B 1,25 3,0E-07 5,2E-04 6,65 AA775249 Hs.513633 G protein-coupled receptor 56 GPR56 -1,63 4,3E-07 6,4E-04 6,33 AA012822 Hs.713814 Oxysterol bining protein OSBP 1,35 5,3E-07 7,1E-04 6,14 R45592 Hs.655271 Regulating synaptic membrane exocytosis 2 RIMS2 2,51 5,9E-07 7,1E-04 6,04 AA282936 Hs.240 M-phase phosphoprotein 1 MPHOSPH -1,40 8,1E-07 8,9E-04 5,74 N34945 Hs.234898 Acetyl-Coenzyme A carboxylase beta ACACB 0,87 9,7E-07 9,8E-04 5,58 R07322 Hs.464137 Acyl-Coenzyme A oxidase 1, palmitoyl ACOX1 0,82 1,3E-06 1,2E-03 5,35 R77144 Hs.488835 Transmembrane protein 120A TMEM120A 1,55 1,7E-06 1,4E-03 5,07 H68542 Hs.420009 Transcribed locus 1,07 1,7E-06 1,4E-03 5,06 AA410184 Hs.696454 PBX/knotted 1 homeobox 2 PKNOX2 1,78 2,0E-06
    [Show full text]
  • Lysine Methylation Regulators Moonlighting Outside the Epigenome Evan Cornett, Laure Ferry, Pierre-Antoine Defossez, Scott Rothbart
    Lysine Methylation Regulators Moonlighting outside the Epigenome Evan Cornett, Laure Ferry, Pierre-Antoine Defossez, Scott Rothbart To cite this version: Evan Cornett, Laure Ferry, Pierre-Antoine Defossez, Scott Rothbart. Lysine Methylation Regulators Moonlighting outside the Epigenome. Molecular Cell, Elsevier, 2019, 10.1016/j.molcel.2019.08.026. hal-02359890 HAL Id: hal-02359890 https://hal.archives-ouvertes.fr/hal-02359890 Submitted on 14 Nov 2019 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Lysine methylation regulators moonlighting outside the epigenome Evan M. Cornett1, Laure Ferry2, Pierre-Antoine Defossez2, and Scott B. RothBart1* 1Center for Epigenetics, Van Andel Research Institute, Grand Rapids, MI 49503, USA. 2Université de Paris, Epigenetics and Cell Fate, CNRS, F-75013 Paris, France. *Correspondence: [email protected], 616-234-5367 ABSTRACT Landmark discoveries made nearly two decades ago identified known transcriptional regulators as histone lysine methyltransferases; since then the field of lysine methylation signaling has Been dominated By studies of how this small chemical posttranslational modification regulates gene expression and other chromatin-Based processes. However, recent advances in mass spectrometry-Based proteomics have revealed that histones are just a suBset of the thousands of eukaryotic proteins marked By lysine methylation.
    [Show full text]
  • Gene Expression Signatures of Sporadic ALS Motor Neuron Populations
    bioRxiv preprint doi: https://doi.org/10.1101/038448; this version posted February 1, 2016. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Gene Expression Signatures of Sporadic ALS Motor Neuron Populations Ranjan Batra1,2, §, Kasey Hutt1, § , Anthony Vu1, §, Stuart J. Rabin3, Michael W. Baughn2, Ryan T. Libby3 , Shawn Hoon4, John Ravits2,*, Gene W. Yeo1,2,4,5,* Affiliations: 1Department of Cellular and Molecular Medicine, Stem cell Program and Institute for Genomic Medicine, University of California at San Diego, La Jolla, California, USA 2Department of Neurosciences, University of California at San Diego, La Jolla 3 Neurogenomics Lab, Benaroya Research Institute, Seattle, WA, USA 4Department of Physiology, Yong Loo Lin School of Medicine, National University of Singapore, Singapore 5Molecular Engineering Laboratory, A*STAR, Singapore §These authors contributed equally to this work *Corresponding authors: [email protected], [email protected] bioRxiv preprint doi: https://doi.org/10.1101/038448; this version posted February 1, 2016. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Abstract Background: Amyotrophic lateral sclerosis (ALS) is a fatal neurodegenerative disease primarily affecting motor neurons (MNs) to cause progressive paralysis. Ninety percent of cases are sporadic (sALS) and ten percent are familial (fALS). The molecular mechanisms underlying neurodegeneration remain elusive and there is a lack of promising biomarkers that define ALS phenotypes and progression. To date, most expression studies have focused on either complex whole tissues that contain cells other than MNs or induced pluripotent derived MNs (iMNs).
    [Show full text]
  • The Proteasomal Deubiquitinating Enzyme PSMD14 Regulates Macroautophagy by Controlling Golgi-To-ER Retrograde Transport
    Supplementary Materials The proteasomal deubiquitinating enzyme PSMD14 regulates macroautophagy by controlling Golgi-to-ER retrograde transport Bustamante HA., et al. Figure S1. siRNA sequences directed against human PSMD14 used for Validation Stage. Figure S2. Primer pairs sequences used for RT-qPCR. Figure S3. The PSMD14 DUB inhibitor CZM increases the Golgi apparatus area. Immunofluorescence microscopy analysis of the Golgi area in parental H4 cells treated for 4 h either with the vehicle (DMSO; Control) or CZM. The Golgi marker GM130 was used to determine the region of interest in each condition. Statistical significance was determined by Student's t-test. Bars represent the mean ± SEM (n =43 cells). ***P <0.001. Figure S4. CZM causes the accumulation of KDELR1-GFP at the Golgi apparatus. HeLa cells expressing KDELR1-GFP were either left untreated or treated with CZM for 30, 60 or 90 min. Cells were fixed and representative confocal images were acquired. Figure S5. Effect of CZM on proteasome activity. Parental H4 cells were treated either with the vehicle (DMSO; Control), CZM or MG132, for 90 min. Protein extracts were used to measure in vitro the Chymotrypsin-like peptidase activity of the proteasome. The enzymatic activity was quantified according to the cleavage of the fluorogenic substrate Suc-LLVY-AMC to AMC, and normalized to that of control cells. The statistical significance was determined by One-Way ANOVA, followed by Tukey’s test. Bars represent the mean ± SD of biological replicates (n=3). **P <0.01; n.s., not significant. Figure S6. Effect of CZM and MG132 on basal macroautophagy. (A) Immunofluorescence microscopy analysis of the subcellular localization of LC3 in parental H4 cells treated with either with the vehicle (DMSO; Control), CZM for 4 h or MG132 for 6 h.
    [Show full text]
  • Molecular Signatures Differentiate Immune States in Type 1 Diabetes Families
    Page 1 of 65 Diabetes Molecular signatures differentiate immune states in Type 1 diabetes families Yi-Guang Chen1, Susanne M. Cabrera1, Shuang Jia1, Mary L. Kaldunski1, Joanna Kramer1, Sami Cheong2, Rhonda Geoffrey1, Mark F. Roethle1, Jeffrey E. Woodliff3, Carla J. Greenbaum4, Xujing Wang5, and Martin J. Hessner1 1The Max McGee National Research Center for Juvenile Diabetes, Children's Research Institute of Children's Hospital of Wisconsin, and Department of Pediatrics at the Medical College of Wisconsin Milwaukee, WI 53226, USA. 2The Department of Mathematical Sciences, University of Wisconsin-Milwaukee, Milwaukee, WI 53211, USA. 3Flow Cytometry & Cell Separation Facility, Bindley Bioscience Center, Purdue University, West Lafayette, IN 47907, USA. 4Diabetes Research Program, Benaroya Research Institute, Seattle, WA, 98101, USA. 5Systems Biology Center, the National Heart, Lung, and Blood Institute, the National Institutes of Health, Bethesda, MD 20824, USA. Corresponding author: Martin J. Hessner, Ph.D., The Department of Pediatrics, The Medical College of Wisconsin, Milwaukee, WI 53226, USA Tel: 011-1-414-955-4496; Fax: 011-1-414-955-6663; E-mail: [email protected]. Running title: Innate Inflammation in T1D Families Word count: 3999 Number of Tables: 1 Number of Figures: 7 1 For Peer Review Only Diabetes Publish Ahead of Print, published online April 23, 2014 Diabetes Page 2 of 65 ABSTRACT Mechanisms associated with Type 1 diabetes (T1D) development remain incompletely defined. Employing a sensitive array-based bioassay where patient plasma is used to induce transcriptional responses in healthy leukocytes, we previously reported disease-specific, partially IL-1 dependent, signatures associated with pre and recent onset (RO) T1D relative to unrelated healthy controls (uHC).
    [Show full text]
  • Target Gene Gene Description Validation Diana Miranda
    Supplemental Table S1. Mmu-miR-183-5p in silico predicted targets. TARGET GENE GENE DESCRIPTION VALIDATION DIANA MIRANDA MIRBRIDGE PICTAR PITA RNA22 TARGETSCAN TOTAL_HIT AP3M1 adaptor-related protein complex 3, mu 1 subunit V V V V V V V 7 BTG1 B-cell translocation gene 1, anti-proliferative V V V V V V V 7 CLCN3 chloride channel, voltage-sensitive 3 V V V V V V V 7 CTDSPL CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like V V V V V V V 7 DUSP10 dual specificity phosphatase 10 V V V V V V V 7 MAP3K4 mitogen-activated protein kinase kinase kinase 4 V V V V V V V 7 PDCD4 programmed cell death 4 (neoplastic transformation inhibitor) V V V V V V V 7 PPP2R5C protein phosphatase 2, regulatory subunit B', gamma V V V V V V V 7 PTPN4 protein tyrosine phosphatase, non-receptor type 4 (megakaryocyte) V V V V V V V 7 EZR ezrin V V V V V V 6 FOXO1 forkhead box O1 V V V V V V 6 ANKRD13C ankyrin repeat domain 13C V V V V V V 6 ARHGAP6 Rho GTPase activating protein 6 V V V V V V 6 BACH2 BTB and CNC homology 1, basic leucine zipper transcription factor 2 V V V V V V 6 BNIP3L BCL2/adenovirus E1B 19kDa interacting protein 3-like V V V V V V 6 BRMS1L breast cancer metastasis-suppressor 1-like V V V V V V 6 CDK5R1 cyclin-dependent kinase 5, regulatory subunit 1 (p35) V V V V V V 6 CTDSP1 CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1 V V V V V V 6 DCX doublecortin V V V V V V 6 ENAH enabled homolog (Drosophila) V V V V V V 6 EPHA4 EPH receptor A4 V V V V V V 6 FOXP1 forkhead box P1 V
    [Show full text]
  • Control of Lineage Commitment in Acute Leukaemia
    NEWCASTLE UNIVERSITY Control of Lineage Commitment in Acute Leukaemia Ricky Fong Tirtakusuma Northern Institute for Cancer Research Faculty of Medical Sciences Doctor of Philosophy September 2018 Abstract Acute leukaemia with the t(4;11) translocation is strongly associated with pro B-acute lymphoblastic phenotype. Here is described a lineage switch from acute lymphoblastic leukaemia (ALL) to acute myeloid leukaemia (AML) which carries identical t(4;11) breakpoints that provides insight into regulation of lineage commitment and the haematopoietic origin of leukaemia. Stable DNA microsatellite sequences argue against a therapy-related AML. Genome sequencing and RNAseq identified 12 novel and deleterious mutations unique to the AML. Immunoglobulin rearrangement analysis suggested the common cell of origin lied within a population prior to B cell differentiation. Sorting of haematopoietic stem/progenitor cell populations followed by multiplex PCR and next generation sequencing for the fusion and secondary mutations demonstrated the occurrence of the leukaemogenic MLL-AF4 fusion gene in cell populations as early as the multipotent progenitor, MPP, population in both ALL and AML. In this most primitive population, the AML carries mutations in chromatin modulating genes CHD4 and PHF3, suggesting their importance in lineage commitment. Knockdown CHD4 and PHF3 individually and in combination in the pro-B ALL t(4;11) SEM cell line resulted in ~3 fold higher expression of the myeloid cell surface marker CD33. Further analysis was performed using a recently described model of MLL-AF4 leukaemogenesis consisting of CD34+ cord blood cells transduced with a chimeric MLL-Af4 fusion gene. Knockdown of CHD4 and PHF3 resulted in loss of lymphoid differentiation potential in vitro.
    [Show full text]
  • (B6;129.Cg-Gt(ROSA)26Sor Tm20(CAG-Ctgf-GFP)Jsd) Were Crossed with Female Foxd1cre/+ Heterozygote Mice 1, and Experimental Mice Were Selected As Foxd1cre/+; Rs26cig/+
    Supplemental Information SI Methods Animal studies Heterozygote mice (B6;129.Cg-Gt(ROSA)26Sor tm20(CAG-Ctgf-GFP)Jsd) were crossed with female Foxd1Cre/+ heterozygote mice 1, and experimental mice were selected as Foxd1Cre/+; Rs26CIG/+. In some studies Coll-GFPTg or TCF/Lef:H2B-GFPTg mice or Foxd1Cre/+; Rs26tdTomatoR/+ mice were used as described 2; 3. Left kidneys were subjected to ureteral obstruction using a posterior surgical approach as described 2. In some experiments recombinant mouse DKK1 (0.5mg/kg) or an equal volume of vehicle was administered by daily IP injection. In the in vivo ASO experiment, either specific Lrp6 (TACCTCAATGCGATTT) or scrambled negative control ASO (AACACGTCTATACGC) (30mg/kg) (Exiqon, LNA gapmers) was administered by IP injection on d-1, d1, d4, and d7. In other experiments anti-CTGF domain-IV antibodies (5mg/kg) or control IgG were administered d-1, d1 and d6. All animal experiments were performed under approved IACUC protocols held at the University of Washington and Biogen. Recombinant protein and antibody generation and characterization Human CTGF domain I (sequence Met1 CPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFC), domain I+II (sequence Met1CPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFCCIFGGT VYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEE) were cloned and expressed in 293 cells, and purified by Chelating SFF(Ni) Column, tested for single band by SEC and PAGE, and tested for absence of contamination. Domain-IV (sequence GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGE VMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMY) was purchased from Peprotech. Mouse or human DKK1 was generated from the coding sequence with some modifications and a tag. Secreted protein was harvested from 293 cells, and purified by nickel column, and tested for activity in a supertopflash (STF) assay 4. DKK1 showed EC50 of 0.69nM for WNT3a-induced WNT signaling in STF cells.
    [Show full text]
  • Content Based Search in Gene Expression Databases and a Meta-Analysis of Host Responses to Infection
    Content Based Search in Gene Expression Databases and a Meta-analysis of Host Responses to Infection A Thesis Submitted to the Faculty of Drexel University by Francis X. Bell in partial fulfillment of the requirements for the degree of Doctor of Philosophy November 2015 c Copyright 2015 Francis X. Bell. All Rights Reserved. ii Acknowledgments I would like to acknowledge and thank my advisor, Dr. Ahmet Sacan. Without his advice, support, and patience I would not have been able to accomplish all that I have. I would also like to thank my committee members and the Biomed Faculty that have guided me. I would like to give a special thanks for the members of the bioinformatics lab, in particular the members of the Sacan lab: Rehman Qureshi, Daisy Heng Yang, April Chunyu Zhao, and Yiqian Zhou. Thank you for creating a pleasant and friendly environment in the lab. I give the members of my family my sincerest gratitude for all that they have done for me. I cannot begin to repay my parents for their sacrifices. I am eternally grateful for everything they have done. The support of my sisters and their encouragement gave me the strength to persevere to the end. iii Table of Contents LIST OF TABLES.......................................................................... vii LIST OF FIGURES ........................................................................ xiv ABSTRACT ................................................................................ xvii 1. A BRIEF INTRODUCTION TO GENE EXPRESSION............................. 1 1.1 Central Dogma of Molecular Biology........................................... 1 1.1.1 Basic Transfers .......................................................... 1 1.1.2 Uncommon Transfers ................................................... 3 1.2 Gene Expression ................................................................. 4 1.2.1 Estimating Gene Expression ............................................ 4 1.2.2 DNA Microarrays ......................................................
    [Show full text]
  • Receptor Signaling Through Osteoclast-Associated Monocyte
    Downloaded from http://www.jimmunol.org/ by guest on September 29, 2021 is online at: average * The Journal of Immunology The Journal of Immunology , 20 of which you can access for free at: 2015; 194:3169-3179; Prepublished online 27 from submission to initial decision 4 weeks from acceptance to publication February 2015; doi: 10.4049/jimmunol.1402800 http://www.jimmunol.org/content/194/7/3169 Collagen Induces Maturation of Human Monocyte-Derived Dendritic Cells by Signaling through Osteoclast-Associated Receptor Heidi S. Schultz, Louise M. Nitze, Louise H. Zeuthen, Pernille Keller, Albrecht Gruhler, Jesper Pass, Jianhe Chen, Li Guo, Andrew J. Fleetwood, John A. Hamilton, Martin W. Berchtold and Svetlana Panina J Immunol cites 43 articles Submit online. Every submission reviewed by practicing scientists ? is published twice each month by Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Author Choice option Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts http://jimmunol.org/subscription Freely available online through http://www.jimmunol.org/content/suppl/2015/02/27/jimmunol.140280 0.DCSupplemental This article http://www.jimmunol.org/content/194/7/3169.full#ref-list-1 Information about subscribing to The JI No Triage! Fast Publication! Rapid Reviews! 30 days* Why • • • Material References Permissions Email Alerts Subscription Author Choice Supplementary The Journal of Immunology The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2015 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606.
    [Show full text]
  • Autocrine IFN Signaling Inducing Profibrotic Fibroblast Responses By
    Downloaded from http://www.jimmunol.org/ by guest on September 23, 2021 Inducing is online at: average * The Journal of Immunology , 11 of which you can access for free at: 2013; 191:2956-2966; Prepublished online 16 from submission to initial decision 4 weeks from acceptance to publication August 2013; doi: 10.4049/jimmunol.1300376 http://www.jimmunol.org/content/191/6/2956 A Synthetic TLR3 Ligand Mitigates Profibrotic Fibroblast Responses by Autocrine IFN Signaling Feng Fang, Kohtaro Ooka, Xiaoyong Sun, Ruchi Shah, Swati Bhattacharyya, Jun Wei and John Varga J Immunol cites 49 articles Submit online. Every submission reviewed by practicing scientists ? is published twice each month by Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts http://jimmunol.org/subscription Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html http://www.jimmunol.org/content/suppl/2013/08/20/jimmunol.130037 6.DC1 This article http://www.jimmunol.org/content/191/6/2956.full#ref-list-1 Information about subscribing to The JI No Triage! Fast Publication! Rapid Reviews! 30 days* Why • • • Material References Permissions Email Alerts Subscription Supplementary The Journal of Immunology The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2013 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. This information is current as of September 23, 2021. The Journal of Immunology A Synthetic TLR3 Ligand Mitigates Profibrotic Fibroblast Responses by Inducing Autocrine IFN Signaling Feng Fang,* Kohtaro Ooka,* Xiaoyong Sun,† Ruchi Shah,* Swati Bhattacharyya,* Jun Wei,* and John Varga* Activation of TLR3 by exogenous microbial ligands or endogenous injury-associated ligands leads to production of type I IFN.
    [Show full text]