Produktinformation

Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien

Weitere Information auf den folgenden Seiten! See the following pages for more information!

Lieferung & Zahlungsart

Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic VPS25 monoclonal antibody (M02), clone 4D6-2D4

Catalog # : H00084313-M02 規格 : [ 100 ug ] List All

Specification Application Image

Product Mouse monoclonal antibody raised against a full-length recombinant Western Blot (Recombinant protein) Description: VPS25. ELISA Immunogen: VPS25 (AAH06282, 1 a.a. ~ 176 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence: MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQS SMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSF LIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLD EATLLRALQALQQEHKAEIITVSDGRGVKFF

Host: Mouse

Reactivity: Human

Isotype: IgG1 Kappa

Quality Control Antibody Reactive Against Recombinant Protein. Testing:

Western Blot detection against Immunogen (45.1 KDa) .

Storage Buffer: In 1x PBS, pH 7.4

Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction:

MSDS: Download

Datasheet: Download

Applications

Western Blot (Recombinant protein) Protocol Download

ELISA

Gene Information

Entrez GeneID: 84313 Page 1 of 2 2020/7/14 GeneBank BC006282 Accession#:

Protein AAH06282 Accession#:

Gene Name: VPS25

Gene Alias: DERP9,EAP20,FAP20,MGC10540

Gene vacuolar protein sorting 25 homolog (S. cerevisiae) Description:

Omim ID: 610907

Gene Ontology: Hyperlink

Gene Summary: VPS25, VPS36 (MIM 610903), and SNF8 (MIM 610904) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. VPS25, VPS36, and SNF8 are also associated in a multiprotein complex with RNA polymerase II elongation factor (ELL; MIM 600284) (Slagsvold et al., 2005 [PubMed 15755741]; Kamura et al., 2001 [PubMed 11278625]).[supplied by OMIM

Other vacuolar protein sorting 25 Designations:

Gene Pathway Endocytosis

Related Disease Cardiovascular Diseases Diabetes Mellitus, Type 2 Edema

Page 2 of 2 2020/7/14