SEZ6 Rabbit Polyclonal Antibody – TA337738 | Origene

Total Page：16

File Type：pdf, Size：1020Kb

SEZ6 Rabbit Polyclonal Antibody – TA337738 | Origene

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA337738 SEZ6 Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-SEZ6 antibody is: synthetic peptide directed towards the C-terminal region of Human SEZ6. Synthetic peptide located within the following region: RAPKCLLEQLKPCHGLSAPENGARSPEKQLHPAGATIHFSCAPGYVLKGQ Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Affinity Purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 105 kDa Gene Name: seizure related 6 homolog Database Link: NP_849191 Entrez Gene 124925 Human Q53EL9 Background: SEZ6 may play a role in cell-cell recognition and in neuronal membrane signaling. It seems to be important for the achievement of the necessary balance between dendrite elongation and branching during the elaboration of a complex dendritic arbor. SEZ6 is involved in the development of appropriate excitatory synaptic connectivity. Synonyms: BSRPC This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 SEZ6 Rabbit Polyclonal Antibody – TA337738 Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Dog: 86%; Rabbit: 86% Protein Families: Druggable Genome, Transmembrane Product images: WB Suggested Anti-SEZ6 Antibody; Titration: 1.0 ug/ml; Positive Control: PANC1 Whole Cell This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 2.

Copy Link

Recommended publications

Single Cell Derived Clonal Analysis of Human Glioblastoma Links
SUPPLEMENTARY INFORMATION: Single cell derived clonal analysis of human glioblastoma links functional and genomic heterogeneity ! Mona Meyer*, Jüri Reimand*, Xiaoyang Lan, Renee Head, Xueming Zhu, Michelle Kushida, Jane Bayani, Jessica C. Pressey, Anath Lionel, Ian D. Clarke, Michael Cusimano, Jeremy Squire, Stephen Scherer, Mark Bernstein, Melanie A. Woodin, Gary D. Bader**, and Peter B. Dirks**! ! * These authors contributed equally to this work.! ** Correspondence: [email protected] or [email protected]! ! Supplementary information - Meyer, Reimand et al. Supplementary methods" 4" Patient samples and ﬂuorescence activated cell sorting (FACS)! 4! Differentiation! 4! Immunocytochemistry and EdU Imaging! 4! Proliferation! 5! Western blotting ! 5! Temozolomide treatment! 5! NCI drug library screen! 6! Orthotopic injections! 6! Immunohistochemistry on tumor sections! 6! Promoter methylation of MGMT! 6! Fluorescence in situ Hybridization (FISH)! 7! SNP6 microarray analysis and genome segmentation! 7! Calling copy number alterations! 8! Mapping altered genome segments to genes! 8! Recurrently altered genes with clonal variability! 9! Global analyses of copy number alterations! 9! Phylogenetic analysis of copy number alterations! 10! Microarray analysis! 10! Gene expression differences of TMZ resistant and sensitive clones of GBM-482! 10! Reverse transcription-PCR analyses! 11! Tumor subtype analysis of TMZ-sensitive and resistant clones! 11! Pathway analysis of gene expression in the TMZ-sensitive clone of GBM-482! 11! Supplementary ﬁgures and tables" 13" "2 Supplementary information - Meyer, Reimand et al. Table S1: Individual clones from all patient tumors are tumorigenic. ! 14! Fig. S1: clonal tumorigenicity.! 15! Fig. S2: clonal heterogeneity of EGFR and PTEN expression.! 20! Fig. S3: clonal heterogeneity of proliferation.! 21! Fig.
[Show full text]
Characterization of a De Novo Ssmc 17 Detected in a Girl With
Stavber et al. Molecular Cytogenetics (2017) 10:10 DOI 10.1186/s13039-017-0312-x CASEREPORT Open Access Characterization of a de novo sSMC 17 detected in a girl with developmental delay and dysmorphic features Lana Stavber1, Sara Bertok2, Jernej Kovač1, Marija Volk3, Luca Lovrečić3, Tadej Battelino2,4 and Tinka Hovnik1* Abstract Background: The majority of small supernumerary marker chromosome cases arise de novo and their frequency in newborns is 0.04%. We report on a girl with developmental delay and dysmorphic features with a non-mosaic de novo sSMC that originated from the pericentric region of q arm in chromosome 17. Case presentation: The girl presented with developmental delay, speech delay, myopia, mild muscle hypotonia, hypoplasia of orbicular muscle, poor concentration, and hyperactivity. Main dysmorphic features included: round face, microstomia, small chin, down-slanting palpebral fissures and small lobules of both ears. At present, her developmental abilities are still delayed for her chronological age but she is making evident progress with speech. A postnatal array comparative genomic hybridization showed a 2.31 Mb genomic gain indicating microduplication derived from pericentric regions q11.1 and q11.2 of chromosome 17. Additional conventional cytogenetic analysis from peripheral blood characterized the karyotype as 47,XX,+mar in a non-mosaic form. The location of microduplication was confirmed with fluorescence in situ hybridization. Conclusion: The proband’s microduplication encompassed approximately 40 annotated genes,
[Show full text]
Mult Mai Muloqoti Taite
US009993566B2MULT MAIMULOQOTI TAITE (12 ) United States Patent ( 10 ) Patent No. : US 9 , 993 ,566 B2 Liu et al. (45 ) Date of Patent : * Jun. 12 , 2018 ( 54 ) SEZ6 MODULATORS AND METHODS OF ( 56 ) References Cited USE U . S . PATENT DOCUMENTS @(71 ) Applicant : AbbVie Stemcentrx LLC , North 5 , 112 , 946 A 5 / 1992 Maione Chicago , IL (US ) 5 ,336 ,603 A 8 / 1994 Capon et al. 5 , 349 ,053 A 9 / 1994 Landolfi @(72 ) Inventors : David Liu , South San Francisco , CA 5 , 359 ,046 A 10 / 1994 Capon et al. (US ) ; Deepti Rokkam , Sunnyvale , CA 5 , 447 , 851 A 9 / 1995 Beutler et al. (US ) ; Sheila Bheddah , San Francisco , 5 , 530 , 101 A 6 / 1996 Queen et al. 5 ,622 , 929 A 4 / 1997 Willner et al . CA (US ) ; Javier Lopez -Molina , New 5 ,693 , 762 A 12 / 1997 Queen et al . York , NY (US ) ; Laura Saunders, San 6 ,180 , 370 B1 1 / 2001 Queen et al . Francisco , CA (US ) 6 , 214 , 345 B1 4 / 2001 Firestone et al. 6 , 362 , 331 B1 3 / 2002 Kamal et al. @ 7 , 049 , 311 B1 5 /2006 Thurston et al . ( 73 ) Assignee : AbbVie Stemcentrx LLC , North 7 , 087 , 409 B2 9 / 2006 Barbas, III et al . Chicago , IL (US ) 7 , 189 , 710 B2 3 / 2007 Kamal et al. 7 , 407 , 951 B2 8 / 2008 Thurston et al. ( * ) Notice : Subject to any disclaimer , the term of this 7 , 422 , 739 B2 9 / 2008 Anderson et al . patent is extended or adjusted under 35 7 , 429 , 658 B2 9 / 2008 Howard et al . U . S . C . 154 (b ) by 0 days.
[Show full text]
Peripheral Nerve Single-Cell Analysis Identifies Mesenchymal Ligands That Promote Axonal Growth
Research Article: New Research Development Peripheral Nerve Single-Cell Analysis Identifies Mesenchymal Ligands that Promote Axonal Growth Jeremy S. Toma,1 Konstantina Karamboulas,1,ª Matthew J. Carr,1,2,ª Adelaida Kolaj,1,3 Scott A. Yuzwa,1 Neemat Mahmud,1,3 Mekayla A. Storer,1 David R. Kaplan,1,2,4 and Freda D. Miller1,2,3,4 https://doi.org/10.1523/ENEURO.0066-20.2020 1Program in Neurosciences and Mental Health, Hospital for Sick Children, 555 University Avenue, Toronto, Ontario M5G 1X8, Canada, 2Institute of Medical Sciences University of Toronto, Toronto, Ontario M5G 1A8, Canada, 3Department of Physiology, University of Toronto, Toronto, Ontario M5G 1A8, Canada, and 4Department of Molecular Genetics, University of Toronto, Toronto, Ontario M5G 1A8, Canada Abstract Peripheral nerves provide a supportive growth environment for developing and regenerating axons and are es- sential for maintenance and repair of many non-neural tissues. This capacity has largely been ascribed to paracrine factors secreted by nerve-resident Schwann cells. Here, we used single-cell transcriptional profiling to identify ligands made by different injured rodent nerve cell types and have combined this with cell-surface mass spectrometry to computationally model potential paracrine interactions with peripheral neurons. These analyses show that peripheral nerves make many ligands predicted to act on peripheral and CNS neurons, in- cluding known and previously uncharacterized ligands. While Schwann cells are an important ligand source within injured nerves, more than half of the predicted ligands are made by nerve-resident mesenchymal cells, including the endoneurial cells most closely associated with peripheral axons. At least three of these mesen- chymal ligands, ANGPT1, CCL11, and VEGFC, promote growth when locally applied on sympathetic axons.
[Show full text]
Familial Partial Epilepsy with Variable Foci in a Dutch Family: Clinical Characteristics and Confirmation of Linkage to Chromosome 22Q
Genetic epidemiological approaches in complex neurological disorders Hottenga, J.J. Citation Hottenga, J. J. (2005, November 10). Genetic epidemiological approaches in complex neurological disorders. Retrieved from https://hdl.handle.net/1887/4343 Version: Corrected Publisher’s Version Licence agreement concerning inclusion of License: doctoral thesis in the Institutional Repository of the University of Leiden Downloaded from: https://hdl.handle.net/1887/4343 Note: To cite this publication please use the final published version (if applicable). CHAPTER 8 Familial partial epilepsy with variable foci in a Dutch family: clinical characteristics and confirmation of linkage to chromosome 22q PMC Callenbach1, AMJM van den Maagdenberg1,2, JJ Hottenga2, EH van den Boogerd2, RFM de Coo3, D Lindhout4, RR Frants2, LA Sandkuijl5†, OF Brouwer1,6. 1. Department of Neurology, Leiden University Medical Center, Leiden, the Netherlands. 2. Department of Human Genetics, Leiden University Medical Center, Leiden, the Netherlands. 3. Department of Pediatric Neurology, Erasmus Medical Center Rotterdam, Rotterdam, the Netherlands. 4. Department of Medical Genetics, University Medical Center Utrecht, Utrecht, the Netherlands. 5. Department of Medical Statistics, Leiden University Medical Center, Leiden, the Netherlands. 6. Department of Neurology, University Hospital Groningen, Groningen, the Netherlands. † In memory of Lodewijk A. Sandkuijl Epilepsia 2003 44:1298-305. FPEVF linkage to chromosome 22q Abstract Purpose: Three forms of idiopathic partial epilepsy with autosomal dominant inheritance have been described: (1) autosomal dominant nocturnal frontal lobe epilepsy (ADNFLE); (2) autosomal dominant lateral temporal epilepsy (ADLTE) or partial epilepsy with auditory features (ADPEAF); and (3) familial partial epilepsy with variable foci (FPEVF). Here, we describe linkage analysis in a Dutch four-generation family with epilepsy fulfilling criteria of both ADNFLE and FPEVF.
[Show full text]
Genome-Wide Gene Expression Profiling of Randall's Plaques In
CLINICAL RESEARCH www.jasn.org Genome-Wide Gene Expression Profiling of Randall’s Plaques in Calcium Oxalate Stone Formers † † Kazumi Taguchi,* Shuzo Hamamoto,* Atsushi Okada,* Rei Unno,* Hideyuki Kamisawa,* Taku Naiki,* Ryosuke Ando,* Kentaro Mizuno,* Noriyasu Kawai,* Keiichi Tozawa,* Kenjiro Kohri,* and Takahiro Yasui* *Department of Nephro-urology, Nagoya City University Graduate School of Medical Sciences, Nagoya, Japan; and †Department of Urology, Social Medical Corporation Kojunkai Daido Hospital, Daido Clinic, Nagoya, Japan ABSTRACT Randall plaques (RPs) can contribute to the formation of idiopathic calcium oxalate (CaOx) kidney stones; however, genes related to RP formation have not been identified. We previously reported the potential therapeutic role of osteopontin (OPN) and macrophages in CaOx kidney stone formation, discovered using genome-recombined mice and genome-wide analyses. Here, to characterize the genetic patho- genesis of RPs, we used microarrays and immunohistology to compare gene expression among renal papillary RP and non-RP tissues of 23 CaOx stone formers (SFs) (age- and sex-matched) and normal papillary tissue of seven controls. Transmission electron microscopy showed OPN and collagen expression inside and around RPs, respectively. Cluster analysis revealed that the papillary gene expression of CaOx SFs differed significantly from that of controls. Disease and function analysis of gene expression revealed activation of cellular hyperpolarization, reproductive development, and molecular transport in papillary tissue from RPs and non-RP regions of CaOx SFs. Compared with non-RP tissue, RP tissue showed upregulation (˃2-fold) of LCN2, IL11, PTGS1, GPX3,andMMD and downregulation (0.5-fold) of SLC12A1 and NALCN (P,0.01). In network and toxicity analyses, these genes associated with activated mitogen- activated protein kinase, the Akt/phosphatidylinositol 3-kinase pathway, and proinflammatory cytokines that cause renal injury and oxidative stress.
[Show full text]
A Genetically Defined Disease Model Reveals That Urothelial Cells Can Initiate Divergent Bladder Cancer Phenotypes
A genetically defined disease model reveals that urothelial cells can initiate divergent bladder cancer phenotypes Liang Wanga,1, Bryan A. Smitha,1, Nikolas G. Balanisb, Brandon L. Tsaia, Kim Nguyena, Michael W. Chenga, Matthew B. Obusana, Favour N. Esedebeb, Saahil J. Patelb, Hanwei Zhangc, Peter M. Clarkb,d,e, Anthony E. Siskf, Jonathan W. Saidf, Jiaoti Huangg, Thomas G. Graeberb,d,e,h, Owen N. Wittea,b,e,h,2, Arnold I. Chinc,e,h,2, and Jung Wook Parka,g,2 aDepartment of Microbiology, Immunology, and Molecular Genetics, University of California, Los Angeles, CA 90095; bDepartment of Molecular and Medical Pharmacology, University of California, Los Angeles, CA 90095; cDepartment of Urology, University of California, Los Angeles, CA 90095; dCrump Institute for Molecular Imaging, University of California, Los Angeles, CA 90095; eEli and Edythe Broad Center of Regenerative Medicine and Stem Cell Research, University of California, Los Angeles, CA 90095; fDepartment of Pathology, University of California, Los Angeles, CA 90095; gDepartment of Pathology, School of Medicine, Duke University, Durham, NC 27710; and hJonsson Comprehensive Cancer Center, University of California, Los Angeles, CA 90095 Contributed by Owen N. Witte, November 12, 2019 (sent for review September 12, 2019; reviewed by Andrew C. Hsieh and Joseph C. Liao) Small cell carcinoma of the bladder (SCCB) is a rare and lethal invasive bladder cancer for decades (5). Recently, immune check- phenotype of bladder cancer. The pathogenesis and molecular features point inhibitors targeting PD-1 or PD-L1 have been approved for the are unknown. Here, we established a genetically engineered SCCB treatment of metastatic bladder cancer (6).
[Show full text]
Mai Muita in Acut Ca Uti on Muunni
MAIMUITA IN ACUTUS010035853B2 CA UTI ON MUUNNI (12 ) United States Patent ( 10 ) Patent No. : US 10 ,035 ,853 B2 Arathoon et al. (45 ) Date of Patent: Jul. 31, 2018 ( 54 ) SITE -SPECIFIC ANTIBODY CONJUGATION 5 , 112 , 946 A 5 / 1992 Maione METHODS AND COMPOSITIONS 5 , 122 , 368 A 6 / 1992 Greenfield et al . 5 , 191 , 066 A 3 / 1993 Bieniarz et al . 5 , 223 , 409 A 6 / 1993 Ladner et al. (71 ) Applicant : ABBVIE STEMCENTRX LLC , North 5 ,336 ,603 A 8 / 1994 Capon et al. Chicago , IL (US ) 5 , 349 ,053 A 9 / 1994 Landolfi 5 , 359 , 046 A 10 / 1994 Capon et al. (72 ) Inventors : William Robert Arathoon , Los Altos 5 , 447 , 851 A 9 / 1995 Beutler et al. 5 , 530 , 101 A 6 / 1996 Queen Hills, CA (US ) ; Ishai Padawer , San 5 , 545 , 806 A 8 / 1996 Lonberg et al. Francisco , CA (US ) ; Luis Antonio 5 , 545 , 807 A 8 / 1996 Surani et al . Cano, Oakland , CA ( US ) ; Vikram 5 , 569 , 825 A 10 / 1996 Lonberg et al . Natwarsinhji Sisodiya , San Francisco , 5 .622 , 929 A 4 / 1997 Willner et al . CA (US ) ; Karthik Narayan Mani, San 5 ,625 , 126 A 4 / 1997 Lonberg et al . 5 ,633 , 425 A 5 / 1997 Lonberg et al . Francisco , CA (US ) ; David Liu , San 5 , 648 , 237 A 7 / 1997 Carter Francisco , CA (US ) 5 ,661 , 016 A 8 / 1997 Lonberg et al . 5 ,693 , 762 A 12 / 1997 Queen et al . ( 73 ) Assignee : AbbVie Stemcentrx LLC , North 5 , 750 , 373 A 5 / 1998 Garrard et al . 5 , 824 , 805 A 10 / 1998 King et al.
[Show full text]
Transcriptome of Embryonic and Neonatal Mouse Cortex by High-Throughput RNA Sequencing
Transcriptome of embryonic and neonatal mouse cortex by high-throughput RNA sequencing Xinwei Hana,b,c, Xia Wua,b, Wen-Yu Chungb,d, Tao Lia,b,e, Anton Nekrutenkob,c,f, Naomi S. Altmanb,g, Gong Chena,b,c,1, and Hong Maa,c,d,h,i,2 aDepartment of Biology, fDepartment of Biochemistry and Molecular Biology, bThe Huck Institutes of the Life Sciences, cIntercollege Graduate Program in Genetics, dDepartment of Computer Science and Engineering, gDepartment of Statistics, Pennsylvania State University, University Park, PA 16802; hState Key Laboratory of Genetic Engineering and Institute of Plant Biology, Center for Evolutionary Biology, School of Life Sciences, Fudan University, Shanghai 200433, China; iInstitutes of Biomedical Sciences, Fudan University, Shanghai 200032, China; and eInstitute of Hydrobiology, Chinese Academy of Sciences, Wuhan, Hubei 430072, China Edited by Nina Fedoroff, U.S. Department of State, Washington, D.C., and approved June 11, 2009 (received for review March 17, 2009) Brain structure and function experience dramatic changes from em- change significantly during hippocampal development from E16 bryonic to postnatal development. Microarray analyses have de- through P30 (11). Also, 366 ProbeSets were found to be differen- tected differential gene expression at different stages and in disease tially expressed during postnatal 2–10 weeks (13). However, mi- models, but gene expression information during early brain devel- croarray technology has several limitations: (1) the number of genes opment is limited. We have generated >27 million reads to identify is fixed; (2) the sensitivity is limited by background hybridization; mRNAs from the mouse cortex for >16,000 genes at either embryonic and (3) the inaccuracy of mRNA levels because of difference in day 18 (E18) or postnatal day 7 (P7), a period of signiﬁcant synapto- hybridization among probes.
[Show full text]
Identification and Mechanistic Investigation of Recurrent Functional Genomic and Transcriptional Alterations in Advanced Prostat
Identification and Mechanistic Investigation of Recurrent Functional Genomic and Transcriptional Alterations in Advanced Prostate Cancer Thomas A. White A dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy University of Washington 2013 Reading Committee: Peter S. Nelson, Chair Janet L. Stanford Raymond J. Monnat Jay A. Shendure Program Authorized to Offer Degree: Molecular and Cellular Biology ©Copyright 2013 Thomas A. White University of Washington Abstract Identification and Mechanistic Investigation of Recurrent Functional Genomic and Transcriptional Alterations in Advanced Prostate Cancer Thomas A. White Chair of the Supervisory Committee: Peter S. Nelson, MD Novel functionally altered transcripts may be recurrent in prostate cancer (PCa) and may underlie lethal and advanced disease and the neuroendocrine small cell carcinoma (SCC) phenotype. We conducted an RNASeq survey of the LuCaP series of 24 PCa xenograft tumors from 19 men, and validated observations on metastatic tumors and PCa cell lines. Key findings include discovery and validation of 40 novel fusion transcripts including one recurrent chimera, many SCC-specific and castration resistance (CR) -specific novel splice isoforms, new observations on SCC-specific and TMPRSS2-ERG specific differential expression, the allele-specific expression of certain recurrent non- synonymous somatic single nucleotide variants (nsSNVs) previously discovered via exome sequencing of the same tumors, rgw ubiquitous A-to-I RNA editing of base excision repair (BER) gene NEIL1 as well as CDK13, a kinase involved in RNA splicing, and the SCC expression of a previously unannotated long noncoding RNA (lncRNA) at Chr6p22.2. Mechanistic investigation of the novel lncRNA indicates expression is regulated by derepression by master neuroendocrine regulator RE1-silencing transcription factor (REST), and may regulate some genes of axonogenesis and angiogenesis.
[Show full text]
The Sez6 Family Inhibits Complement at the Level of the C3 Convertase
bioRxiv preprint doi: https://doi.org/10.1101/2020.09.11.292623; this version posted September 11, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. The Sez6 family inhibits complement at the level of the C3 convertase Wen Q. Qiu1#,, Shaopeiwen Luo1#, Stefanie A. Ma1, Priyanka Saminathan1, Herman Li1, Jenny Gunnersen2, Harris A. Gelbard1, Jennetta W. Hammond1* Author Affiliations: 1. Center for Neurotherapeutics Discovery, Department of Neurology, University of Rochester Medical Center, 601 Elmwood Avenue, Rochester NY 14642. 2. Department of Anatomy and Neuroscience and The Florey Institute of Neuroscience and Mental Health, University of Melbourne, Melbourne, VIC 3010, Australia. #Authors contributed equally to the work *Correspondence: Jennetta W. Hammond University of Rochester Dept. of Neurology, Center for Neurotherapeutics Discovery 601 Elmwood Avenue, Box 645 Rochester, NY 14642, USA [email protected] Keywords: Sez6L2, Sez6, Sez6L complement, classical pathway, alternative pathway, C3 convertase, Factor I cofactor, decay accelerating activity, C3b, C4b. bioRxiv preprint doi: https://doi.org/10.1101/2020.09.11.292623; this version posted September 11, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Abstract The Sez6 family consists of Sez6, Sez6L, and Sez6L2. Its members are expressed throughout the brain and have been shown to influence synapse numbers and dendritic morphology.
[Show full text]
Genome-Wide Association Studies in the Partial Epilepsies CLÁUDIA José Franco Bacanh
GENETIC STUDIES OF THE COMMON EPILEPSIES: genome-wide association studies in the partial epilepsies CLÁUDIA José Franco Bacanhim Santos CATARINO UCL Institute of Neurology Queen Square London WC1N 3BG A thesis for submission to University College London for the degree of Doctor of Philosophy 2013. Abstract This thesis discusses four studies, looking for genetic determinants of common epilepsies: 1) A genome-wide association study (GWAS) of partial epilepsies (PE), which was the first published GWAS in the field of epilepsy (Chapter 4). 2) A GWAS of mesial temporal lobe epilepsy (MTLE) with hippocampal sclerosis (HS) (Chapter 5). 3) A case series of patients with refractory MTLE, operated and found to have large microdeletions at 16p13.11, 15q11.2 and others (Chapter 6). 4) A clinical, genetic and neuropathologic study of a series of patients with Dravet syndrome (DS), diagnosed as adults, including genotype-phenotype correlation analysis (Chapter 7). The main findings include: 1) The GWAS of PE has not yielded any genome-wide significant association with common genetic variants, possibly because of insufficient power and phenotypical heterogeneity. It is, however, a strong foundation for further studies, illustrating the feasibility of large multicentre GWAS in the epilepsies (Chapter 4). 2) The GWAS of MTLEHS yielded a borderline genome-wide statistically significant association with three common genetic variants close or intronic to the SCN1A gene, especially in MTLEHS with antecedents of childhood febrile seizures (Chapter 5). 3) Large microdeletions at 16p13.11 and others were found in patients with MTLEHS and not only in idiopathic non-lesional epilepsies. Good outcome after resective epilepsy surgery is possible in “typical” MTLEHS even with large microdeletions (Chapter 6).
[Show full text]