Characterization of Desulfovibrio Salinus Sp. Nov., a Slightly Halophilic
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Beating the Bugs: Roles of Microbial Biofilms in Corrosion
Beating the bugs: roles of microbial biofilms in corrosion The MIT Faculty has made this article openly available. Please share how this access benefits you. Your story matters. Citation Li, Kwan, Matthew Whitfield, and Krystyn J. Van Vliet. "Beating the bugs: roles of microbial biofilms in corrosion." Corrosion Reviews 321, 3-6 (2013); © 2013, by Walter de Gruyter Berlin Boston. All rights reserved. As Published https://dx.doi.org/10.1515/CORRREV-2013-0019 Publisher Walter de Gruyter GmbH Version Author's final manuscript Citable link https://hdl.handle.net/1721.1/125679 Terms of Use Creative Commons Attribution-Noncommercial-Share Alike Detailed Terms http://creativecommons.org/licenses/by-nc-sa/4.0/ Beating the bugs: Roles of microbial biofilms in corrosion Kwan Li∗,‡, Matthew Whitfield∗,‡, and Krystyn J. Van Vliet∗,† ∗Department of Materials Science and Engineering and †Department of Biological Engineering, Massachusetts Institute of Technology, 77 Massachusetts Avenue, Cambridge, MA 02139 USA ‡These author contributed equally to this work Abstract Microbiologically influenced corrosion is a complex type of environmentally assisted corrosion. Though poorly understood and challenging to ameliorate, it is increasingly appreciated that MIC accelerates failure of metal alloys, including steel pipeline. His- torically, this type of material degradation process has been treated from either an electrochemical materials perspective or a microbiological perspective. Here, we re- view the current understanding of MIC mechanisms for steel – particularly those in sour environments relevant to fossil fuel recovery and processing – and outline the role of the bacterial biofilm in both corrosion processes and mitigation responses. Keywords: biofilm; sulfate-reducing bacteria (SRB); microbiologically influenced cor- rosion (MIC) 1 Introduction Microbiologically influenced corrosion (MIC) can accelerate mechanical failure of metals in a wide range of environments ranging from oil and water pipelines and machinery to biomedical devices. -
Hal 89-106 Alimuddin Enzim
Microbial community of black band disease on infection ... (Ofri Johan) MICROBIAL COMMUNITY OF BLACK BAND DISEASE ON INFECTION, HEALTHY, AND DEAD PART OF SCLERACTINIAN Montipora sp. COLONY AT SERIBU ISLANDS, INDONESIA Ofri Johan*)#, Dietriech G. Bengen**), Neviaty P. Zamani**), Suharsono***), David Smith****), Angela Mariana Lusiastuti*****), and Michael J. Sweet******) *) Research and Development Institute for Ornamental Fish Culture, Jakarta **) Department of Marine Science and Technology, Faculty of Fisheries and Marine Science, Bogor Agricultural University ***) Research Center for Oceanography, The Indonesian Institute of Science ****) School of Biology, Newcastle University, NE1 7RU, United Kingdom *****) Center for Aquaculture Research and Development ******) Biological Sciences Research Group, University of Derby, Kedleston Road, Derby, DE22 1GB, United Kingdom (Received 19 March 2014; Final revised 12 September 2014; Accepted 10 November 2014) ABSTRACT It is crucial to understand the microbial community associated with the host when attempting to discern the pathogen responsible for disease outbreaks in scleractinian corals. This study determines changes in the bacterial community associated with Montipora sp. in response to black band disease in Indonesian waters. Healthy, diseased, and dead Montipora sp. (n = 3 for each sample type per location) were collected from three different locations (Pari Island, Pramuka Island, and Peteloran Island). DGGE (Denaturing Gradient Gel Electrophoresis) was carried out to identify the bacterial community associated with each sample type and histological analysis was conducted to identify pathogens associated with specific tissues. Various Desulfovibrio species were found as novelty to be associated with infection samples, including Desulfovibrio desulfuricans, Desulfovibrio magneticus, and Desulfovibrio gigas, Bacillus benzoevorans, Bacillus farraginis in genus which previously associated with pathogenicity in corals. -
Pila Genes. the Location of Alpha Helices (Represented by Red H) and Beta Strands (Represented by Yellow E) Was Predicted with Jpred 4 (Drozdetskiy Et Al, 2015)
Supplementary Figure S1. Secondary structure of the N-terminus of PilA proteins from Desulfuromondales species and other bacteria that possess type IVa pilA genes. The location of alpha helices (represented by red H) and beta strands (represented by yellow E) was predicted with Jpred 4 (Drozdetskiy et al, 2015). Transmembrane helices (green background) were predicted with TmPred (Hofmann & Stoffel, 1993), TMHMM (Krogh et al, 2001), and HMMTOP (Tusnady & Simon, 2001). G. bemidjiensis (Gbem_2590) MLNKLRSNKGFTLIELLIVVAIIGILAAIAIPQFSAYREKAYNAASNSDLKNFKTGLEAFNADFQTYPAAYVASTN ---HHH----HHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHH-----HHHHHHHHHH-------EEEE--- G. bremensis (K419DRAFT_00801) MLNKLRSNKGFTLIELLIVVAIIGILAAIAIPQFSAYREKAYNAASNSDLKNWKTGQEAYQADFQAYPAAYDVH --HHHH----HHHHHHHHHHHHHHHHHHH----HHHHHHHHHH------HHHHHHHHHHHHHHH---------- Pelobacter seleniigenes (N909DRAFT_0006) MLKKFRKNEKGFTLIELLIVVAIIGILAAIAIPQFASYRQKAFNSASQSDLKTIKTSLEGYYTDEYYYPY --HHHHH-----HHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHH------- Geobacter sp. OR-1 (WP_041974243) MLSKLRSNKGFTLIELLIVVAIIGILAAIAIPQFSAYREKAYNTAANADDKNAKTGEEAYNADNQKYPLAYDQH --HHHHH----HHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHH------------ Geobacter sp. M18 (GM18_2492) MLNKIRSNKGFTLIELLIVVAIIGILAAIAIPQFSAYRAKAYNAAANSDLKNIKTGMEAYMADRQAYPVSLDER --HHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------------ Geobacter sp. M21 MLNKLRSNKGFTLIELLIVVAIIGILAAIAIPQFSAYRAKAYNSAANSDLKNMKTGMEAYMADRQAYPALLDQR --HHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----------- Desulfuromonas -
Desulfovibrio Vulgaris Defenses Against Oxidative and Nitrosative Stresses
Desulfovibrio vulgaris defenses against oxidative and nitrosative stresses Mafalda Cristina de Oliveira Figueiredo Dissertation presented to obtain the Ph.D degree in Biochemistry Instituto de Tecnologia Química e Biológica | Universidade Nova de Lisboa Supervisor: Dr. Lígia M. Saraiva Co-supervisor: Prof. Miguel Teixeira Oeiras, September 2013 From left to right: Carlos Romão (president of the jury), Fernando Antunes (3rd opponent), Ana Melo (4th opponent), Lígia Saraiva (supervisor), Carlos Salgueiro (2nd opponent), Mafalda Figueiredo, Alain Dolla (1st opponent) and Miguel Teixeira (co-supervisor). 17th September 2013 Second edition, October 2013 Molecular Genetics of Microbial Resistance Laboratory Instituto de Tecnologia Química e Biológica Universidade Nova de Lisboa 2780-157 Portugal “Nothing in life is to be feared, it is only to be understood. Now is the time to understand more, so that we may fear less.” Marie Curie Acknowledgments The present work would not have been possible without the help, the support and the friendship of several people whom I would like to formally express my sincere gratitude: Dr. Lígia M. Saraiva Firstly I would like to express my gratitude to my supervisor Dr. Lígia M. Saraiva, without her ideas and persistence I would not have come this far. I thank her for the constant support and encouragement when things did not go so well, for the trust she placed in me and in my work and for always being there when I needed over these five years. I have to thank Dr. Lígia for the good advices and for the careful revision of this thesis. Thanks for everything!!! Prof. Miguel Teixeira To my co-supervisor Prof. -
The Microbial Sulfur Cycle at Extremely Haloalkaline Conditions of Soda Lakes
REVIEW ARTICLE published: 21 March 2011 doi: 10.3389/fmicb.2011.00044 The microbial sulfur cycle at extremely haloalkaline conditions of soda lakes Dimitry Y. Sorokin1,2*, J. Gijs Kuenen 2 and Gerard Muyzer 2 1 Winogradsky Institute of Microbiology, Russian Academy of Sciences, Moscow, Russia 2 Department of Biotechnology, Delft University of Technology, Delft, Netherlands Edited by: Soda lakes represent a unique ecosystem with extremely high pH (up to 11) and salinity (up to Martin G. Klotz, University of Louisville, saturation) due to the presence of high concentrations of sodium carbonate in brines. Despite USA these double extreme conditions, most of the lakes are highly productive and contain a fully Reviewed by: Aharon Oren, The Hebrew University functional microbial system. The microbial sulfur cycle is among the most active in soda lakes. of Jerusalem, Israel One of the explanations for that is high-energy efficiency of dissimilatory conversions of inorganic Yanhe Ma, Institute of Microbiology sulfur compounds, both oxidative and reductive, sufficient to cope with costly life at double Chinese Academy of Sciences, China extreme conditions. The oxidative part of the sulfur cycle is driven by chemolithoautotrophic *Correspondence: haloalkaliphilic sulfur-oxidizing bacteria (SOB), which are unique for soda lakes. The haloalkaliphilic Dimitry Y. Sorokin, Winogradsky Institute of Microbiology, Russian SOB are present in the surface sediment layer of various soda lakes at high numbers of up to Academy of Sciences, Prospect 60-let 106 viable cells/cm3. The culturable forms are so far represented by four novel genera within the Octyabrya 7/2, 117312 Moscow, Russia Gammaproteobacteria, including the genera Thioalkalivibrio, Thioalkalimicrobium, Thioalkalispira, e-mail: [email protected]; and Thioalkalibacter. -
'Candidatus Desulfonatronobulbus Propionicus': a First Haloalkaliphilic
Delft University of Technology ‘Candidatus Desulfonatronobulbus propionicus’ a first haloalkaliphilic member of the order Syntrophobacterales from soda lakes Sorokin, D. Y.; Chernyh, N. A. DOI 10.1007/s00792-016-0881-3 Publication date 2016 Document Version Accepted author manuscript Published in Extremophiles: life under extreme conditions Citation (APA) Sorokin, D. Y., & Chernyh, N. A. (2016). ‘Candidatus Desulfonatronobulbus propionicus’: a first haloalkaliphilic member of the order Syntrophobacterales from soda lakes. Extremophiles: life under extreme conditions, 20(6), 895-901. https://doi.org/10.1007/s00792-016-0881-3 Important note To cite this publication, please use the final published version (if applicable). Please check the document version above. Copyright Other than for strictly personal use, it is not permitted to download, forward or distribute the text or part of it, without the consent of the author(s) and/or copyright holder(s), unless the work is under an open content license such as Creative Commons. Takedown policy Please contact us and provide details if you believe this document breaches copyrights. We will remove access to the work immediately and investigate your claim. This work is downloaded from Delft University of Technology. For technical reasons the number of authors shown on this cover page is limited to a maximum of 10. Extremophiles DOI 10.1007/s00792-016-0881-3 ORIGINAL PAPER ‘Candidatus Desulfonatronobulbus propionicus’: a first haloalkaliphilic member of the order Syntrophobacterales from soda lakes D. Y. Sorokin1,2 · N. A. Chernyh1 Received: 23 August 2016 / Accepted: 4 October 2016 © Springer Japan 2016 Abstract Propionate can be directly oxidized anaerobi- from its members at the genus level. -
Sulfate-Reducing Bacteria in Anaerobic Bioreactors Are Presented in Table 1
Sulfate-reducing Bacteria inAnaerobi c Bioreactors Stefanie J.W.H. Oude Elferink Promotoren: dr. ir. G. Lettinga bijzonder hoogleraar ind eanaërobisch e zuiveringstechnologie en hergebruik dr. W.M. deVo s hoogleraar ind e microbiologie Co-promotor: dr. ir. AJ.M. Stams universitair docent bij deleerstoelgroe p microbiologie ^OSJO^-M'3^- Stefanie J.W.H.Oud eElferin k Sulfate-reducing Bacteria inAnaerobi c Bioreactors Proefschrift terverkrijgin g van degraa d van doctor op gezag van derecto r magnificus van deLandbouwuniversitei t Wageningen, dr. C.M. Karssen, inhe t openbaar te verdedigen opvrijda g 22me i 1998 des namiddags tehal f twee ind eAula . r.r, A tri ISBN 90 5485 8451 The research described inthi s thesiswa s financially supported by agran t ofth e Innovative Oriented Program (IOP) Committee on Environmental Biotechnology (IOP-m 90209) established by the Dutch Ministry of Economics, and a grant from Pâques BV. Environmental Technology, P.O. Box 52, 8560AB ,Balk , TheNetherlands . BIBLIOTHEEK LANDBOUWUNIVERSITEIT WAGENTNGEN 1 (J ÜOB^ . ^3"£ Stellingen 1. Inhu n lijst van mogelijke scenario's voor de anaërobe afbraak van propionaat onder sulfaatrijke condities vergeten Uberoi enBhattachary a het scenario dat ind e anaërobe waterzuiveringsreactor van depapierfabrie k teEerbee k lijkt opt etreden , namelijk de afbraak vanpropionaa t door syntrofen en sulfaatreduceerders end e afbraak van acetaat en waterstof door sulfaatreduceerders en methanogenen. Ditproefschrift, hoofdstuk 7 UberoiV, Bhattacharya SK (1995)Interactions among sulfate reducers, acetogens, and methanogens in anaerobicpropionate systems. 2. De stelling van McCartney en Oleszkiewicz dat sulfaatreduceerders inanaërob e reactoren waarschijnlijk alleen competerenme t methanogenen voor het aanwezige waterstof, omdat acetaatafbrekende sulfaatreduceerders nog nooit uit anaëroob slib waren geïsoleerd, was correct bij indiening, maar achterhaald bij publicatie. -
Quantitative Population Dynamics of Microbial Communities in Plankton-Fed Microbial Fuel Cells
The ISME Journal (2009) 3, 635–646 & 2009 International Society for Microbial Ecology All rights reserved 1751-7362/09 $32.00 www.nature.com/ismej ORIGINAL ARTICLE Quantitative population dynamics of microbial communities in plankton-fed microbial fuel cells Helen K White1, Clare E Reimers2, Erik E Cordes1, Geoffrey F Dilly1 and Peter R Girguis1 1Biological Labs, Department of Organismic and Evolutionary Biology, Harvard University, Cambridge, MA, USA and 2College of Oceanic and Atmospheric Sciences, Hatfield Marine Science Center, Oregon State University, Newport, OR, USA This study examines changes in diversity and abundance of bacteria recovered from the anodes of microbial fuel cells (MFCs) in relation to anode potential, power production and geochemistry. MFCs were batch-fed with plankton, and two systems were maintained at different potentials whereas one was at open circuit for 56.8 days. Bacterial phylogenetic diversity during peak power was assessed from 16S rDNA clone libraries. Throughout the experiment, microbial community structure was examined using terminal restriction fragment length polymorphism. Changes in cell density of key phylotypes, including representatives of d-, e-, c-proteobacteria and Flavobacterium-Cytophaga- Bacteroides, were enumerated by quantitative PCR. Marked differences in phylogenetic diversity were observed during peak power versus the final time point, and changes in microbial community structure were strongly correlated to dissolved organic carbon and ammonium concentrations within the anode chambers. Community structure was notably different between the MFCs at different anode potentials during the onset of peak power. At the final time point, however, the anode-hosted communities in all MFCs were similar. These data demonstrate that differences in growth, succession and population dynamics of key phylotypes were due to anode potential, which may relate to their ability to exploit the anode as an electron acceptor. -
Pseudodesulfovibrio Indicus Gen. Nov., Sp Nov., a Piezophilic Sulfate
1 International Journal Of Systematic And Evolutionary Microbiology Achimer October 2016, Volume 66 Pages 3904-3911 http://dx.doi.org/10.1099/ijsem.0.001286 http://archimer.ifremer.fr http://archimer.ifremer.fr/doc/00359/47018/ © 2016 IUMS Printed in Great Britain Pseudodesulfovibrio indicus gen. nov., sp nov., a piezophilic sulfate-reducing bacterium from the Indian Ocean and reclassification of four species of the genus Desulfovibrio Cao Junwei 1, 2, 3, 4, 5, 6, 7, 8, *, Gayet Nicolas 9, Zeng Xiang 5, 6, 7, 8, Shao Zongze 5, 6, 7, 8, *, Jebbar Mohamed 1, 2, 3, Alain Karine 1, 2, 3, * 1 UBO, UEB, IUEM, UMR 6197,LMEE, Pl Nicolas Copernic, F-29280 Plouzane, France. 2 CNRS, IUEM, UMR 6197, LMEE, Pl Nicolas Copernic, F-29280 Plouzane, France. 3 IFREMER, UMR 6197, LMEE, Technopole Pointe Diable, F-29280 Plouzane, France. 4 Harbin Inst Technol, Sch Municipal & Environm Engn, Harbin 150090, Peoples R China. 5 State Key Lab Breeding Base Marine Genet Resource, Xiamen, Peoples R China. 6 Third Inst State Ocean Adm, Key Lab Marine Genet Resources, Xiamen, Peoples R China. 7 Collaborat Innovat Ctr Marine Biol Resources, Xiamen, Peoples R China. 8 Key Lab Marine Genet Resources Fujian Prov, Xiamen, Peoples R China. 9 IFREMER, Ctr Brest, REM, EEP,LEP,Inst Carnot,EDROME, F-29280 Plouzane, France. *Corresponding authors : email addresses : [email protected] ; [email protected] ; [email protected] Abstract : A novel sulfate-reducing bacterium, strain J2T, was isolated from a serpentinized peridotite sample from the Indian Ocean. Phylogenetic analysis based on 16S rRNA gene sequences showed that strain J2T clustered with the genus Desulfovibrio within the family Desulfovibrionaceae , but it showed low similarity (87.95 %) to the type species Desulfovibrio desulfuricans DSM 642T. -
Ketogenic Diet Enhances Neurovascular Function with Altered
www.nature.com/scientificreports OPEN Ketogenic diet enhances neurovascular function with altered gut microbiome in young healthy Received: 14 September 2017 Accepted: 17 April 2018 mice Published: xx xx xxxx David Ma1, Amy C. Wang1, Ishita Parikh1, Stefan J. Green 2, Jared D. Hofman1,3, George Chlipala2, M. Paul Murphy1,4, Brent S. Sokola5, Björn Bauer5, Anika M. S. Hartz1,3 & Ai-Ling Lin1,3,6 Neurovascular integrity, including cerebral blood fow (CBF) and blood-brain barrier (BBB) function, plays a major role in determining cognitive capability. Recent studies suggest that neurovascular integrity could be regulated by the gut microbiome. The purpose of the study was to identify if ketogenic diet (KD) intervention would alter gut microbiome and enhance neurovascular functions, and thus reduce risk for neurodegeneration in young healthy mice (12–14 weeks old). Here we show that with 16 weeks of KD, mice had signifcant increases in CBF and P-glycoprotein transports on BBB to facilitate clearance of amyloid-beta, a hallmark of Alzheimer’s disease (AD). These neurovascular enhancements were associated with reduced mechanistic target of rapamycin (mTOR) and increased endothelial nitric oxide synthase (eNOS) protein expressions. KD also increased the relative abundance of putatively benefcial gut microbiota (Akkermansia muciniphila and Lactobacillus), and reduced that of putatively pro-infammatory taxa (Desulfovibrio and Turicibacter). We also observed that KD reduced blood glucose levels and body weight, and increased blood ketone levels, which might be associated with gut microbiome alteration. Our fndings suggest that KD intervention started in the early stage may enhance brain vascular function, increase benefcial gut microbiota, improve metabolic profle, and reduce risk for AD. -
Microscopic Methods for Identification of Sulfate-Reducing Bacteria From
International Journal of Molecular Sciences Review Microscopic Methods for Identification of Sulfate-Reducing Bacteria from Various Habitats Ivan Kushkevych 1,* , Blanka Hýžová 1, Monika Vítˇezová 1 and Simon K.-M. R. Rittmann 2,* 1 Department of Experimental Biology, Faculty of Science, Masaryk University, 62500 Brno, Czech Republic; [email protected] (B.H.); [email protected] (M.V.) 2 Archaea Physiology & Biotechnology Group, Department of Functional and Evolutionary Ecology, Universität Wien, 1090 Wien, Austria * Correspondence: [email protected] (I.K.); [email protected] (S.K.-M.R.R.); Tel.: +420-549-495-315 (I.K.); +431-427-776-513 (S.K.-M.R.R.) Abstract: This paper is devoted to microscopic methods for the identification of sulfate-reducing bacteria (SRB). In this context, it describes various habitats, morphology and techniques used for the detection and identification of this very heterogeneous group of anaerobic microorganisms. SRB are present in almost every habitat on Earth, including freshwater and marine water, soils, sediments or animals. In the oil, water and gas industries, they can cause considerable economic losses due to their hydrogen sulfide production; in periodontal lesions and the colon of humans, they can cause health complications. Although the role of these bacteria in inflammatory bowel diseases is not entirely known yet, their presence is increased in patients and produced hydrogen sulfide has a cytotoxic effect. For these reasons, methods for the detection of these microorganisms were described. Apart from selected molecular techniques, including metagenomics, fluorescence microscopy was one of the applied methods. Especially fluorescence in situ hybridization (FISH) in various modifications Citation: Kushkevych, I.; Hýžová, B.; was described. -
Chromate Reduction by Desulfovibrio Desulfuricans ATCC 27774 Ning Zhang
View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Duquesne University: Digital Commons Duquesne University Duquesne Scholarship Collection Electronic Theses and Dissertations 2012 Chromate Reduction by Desulfovibrio Desulfuricans ATCC 27774 Ning Zhang Follow this and additional works at: https://dsc.duq.edu/etd Recommended Citation Zhang, N. (2012). Chromate Reduction by Desulfovibrio Desulfuricans ATCC 27774 (Master's thesis, Duquesne University). Retrieved from https://dsc.duq.edu/etd/1409 This Immediate Access is brought to you for free and open access by Duquesne Scholarship Collection. It has been accepted for inclusion in Electronic Theses and Dissertations by an authorized administrator of Duquesne Scholarship Collection. For more information, please contact [email protected]. CHROMATE REDUCTION BY DESULFOVIBRIO DESULFURICANS ATCC 27774 A Thesis Submitted to the Bayer School of Natural and Environmental Sciences Duquesne University In partial fulfillment of the requirements for the degree of Master of Science in Environmental Science & Management By Ning Zhang May 2012 Copyright by Ning Zhang 2012 CHROMATE REDUCTION BY DESULFOVIBRIO DESULFURICANS ATCC 27774 By Ning Zhang Approved on January 4, 2012 ________________________________ ________________________________ Dr. John F. Stolz Dr. H.M. Skip Kingston Professor of Biology Professor of Analytical Chemistry (Committee Chair) (Committee Member) ________________________________ Dr. Michael J. Tobin Adjunct Professor of Chemistry (Committee Member) ________________________________ ________________________________ Dr. David W. Seybert Dr. John F. Stolz Dean, Bayer School of Natural and Director, Center for Environmental Environmental Sciences Research and Education iii ABSTRACT CHROMATE REDUCTION BY DESULFOVIBRIO DESULFURICANS ATCC 27774 By Ning Zhang May 2012 Dissertation supervised by Dr. John F.