Microscopic Methods for Identification of Sulfate-Reducing Bacteria From

Total Page:16

File Type:pdf, Size:1020Kb

Load more

International Journal of Molecular Sciences Review Microscopic Methods for Identification of Sulfate-Reducing Bacteria from Various Habitats Ivan Kushkevych 1,* , Blanka Hýžová 1, Monika Vítˇezová 1 and Simon K.-M. R. Rittmann 2,* 1 Department of Experimental Biology, Faculty of Science, Masaryk University, 62500 Brno, Czech Republic; [email protected] (B.H.); [email protected] (M.V.) 2 Archaea Physiology & Biotechnology Group, Department of Functional and Evolutionary Ecology, Universität Wien, 1090 Wien, Austria * Correspondence: [email protected] (I.K.); [email protected] (S.K.-M.R.R.); Tel.: +420-549-495-315 (I.K.); +431-427-776-513 (S.K.-M.R.R.) Abstract: This paper is devoted to microscopic methods for the identification of sulfate-reducing bacteria (SRB). In this context, it describes various habitats, morphology and techniques used for the detection and identification of this very heterogeneous group of anaerobic microorganisms. SRB are present in almost every habitat on Earth, including freshwater and marine water, soils, sediments or animals. In the oil, water and gas industries, they can cause considerable economic losses due to their hydrogen sulfide production; in periodontal lesions and the colon of humans, they can cause health complications. Although the role of these bacteria in inflammatory bowel diseases is not entirely known yet, their presence is increased in patients and produced hydrogen sulfide has a cytotoxic effect. For these reasons, methods for the detection of these microorganisms were described. Apart from selected molecular techniques, including metagenomics, fluorescence microscopy was one of the applied methods. Especially fluorescence in situ hybridization (FISH) in various modifications Citation: Kushkevych, I.; Hýžová, B.; was described. This method enables visual identification of SRB, determining their abundance and Vítˇezová,M.; Rittmann, S.K.-M.R. Microscopic Methods for spatial distribution in environmental biofilms and gut samples. Identification of Sulfate-Reducing Bacteria from Various Habitats. Int. J. Keywords: microscopy; fluorescence microscopy; FISH; DAPI; Desulfovibrio; anaerobic microorganisms; Mol. Sci. 2021, 22, 4007. https:// habitats; SRB; SRP; SRM; sulfate reduction; identification; gut microbiota; IBD doi.org/10.3390/ijms22084007 Academic Editors: Márió Gajdács and Edit Urbán 1. Introduction Sulfate-reducing microorganisms (SRM) are a diverse group of anaerobic microorgan- Received: 26 February 2021 isms, which are widely present in nature and play an indispensable role in the sulfur and Accepted: 3 April 2021 carbon cycle on Earth [1]. This group comprises prokaryotes from the domains Bacteria and Published: 13 April 2021 Archaea, encompassing over 220 species from 60 different genera [2–4]. Members of this exceptional physiological group differ from each other in their nutritional requirements Publisher’s Note: MDPI stays neutral 2− and morphology; however, all its representatives use sulfate (SO4 ) or other oxidized with regard to jurisdictional claims in sulfur compounds as a terminal electron acceptor in the oxidation of organic substances [2]. published maps and institutional affil- As this review deals mainly with the representatives of the domain Bacteria, the term iations. sulfate-reducing bacteria (SRB) will be mainly used in the text. SRB can use a wide range of substances as electron donors. For example, molecular hydrogen (H2) and various organic compounds (lactate, acetate, pyruvate, malate, alcohols such as ethanol, propanol or butanol and others) can serve as electron donors in anaerobic Copyright: © 2021 by the authors. respiration [2,5]. Some SRB can also use nitrates as the final electron acceptor, for example, Licensee MDPI, Basel, Switzerland. the representatives of the genera Desulfovibrio or Desulfobacterium [6–9]. Organic substrates This article is an open access article can be oxidized by various species either incompletely to acetate (e.g., by the genus distributed under the terms and Desulfovibrio) or ultimately to carbon dioxide (e.g., by the genus Desulfomicrobium)[10]. conditions of the Creative Commons Attribution (CC BY) license (https:// The process is referred to as dissimilatory sulfate reduction or sulfate respiration. In this creativecommons.org/licenses/by/ process, a small amount of reduced sulfur is assimilated, but most of it is released into the 4.0/). Int. J. Mol. Sci. 2021, 22, 4007. https://doi.org/10.3390/ijms22084007 https://www.mdpi.com/journal/ijms Int. J. Mol. Sci. 2021, 22, x FOR PEER REVIEW 2 of 27 Int. J. Mol. Sci. 2021, 22, 4007 2 of 27 into the environment in the form of a sulfide ion, but usually as hydrogen sulfide (Figure 1). No other microorganisms than SRB are known to be capable of this form of respiration environment in the form of a sulfide ion, but usually as hydrogen sulfide (Figure1). No [11].other microorganisms than SRB are known to be capable of this form of respiration [11]. Figure 1. 1.Scheme Scheme of theof dissimilatorythe dissimilatory sulfate reduction.sulfate reduction. Intensive SRB studies started in 1895 when M. W. Beijerinck discovered an interesting biologicalIntensive activity SRB in a newlystudies isolated started species, in 1895 “Spirillum when desulfuricans M. W. Beijerinck” (later Desulfovibrio discovered an interest- ingdesulfuricans biological). Indeed, activity it was in the a dissimilatorynewly isolated sulfate species, reduction “ activitySpirillum that hedesulfuricans discovered. ” (later Desul- fovibrioMany other desulfuricans scientists went). Indeed, on to study it was SRB andthe new dissimilatory cultivation techniques sulfate reduction of anaerobes, activity that he discovered.and the development Many other of molecular scientists techniques went ledon toto thestudy characterization SRB and new of many cultivation new techniques taxa [2]. Recent studies are aiming to reveal the possible usage of SRB in biotechnology, oftoo, anaerobes, where SRB and can bethe used, development for example, of for molecular bioremediation techniques of toxic led compounds to the characterization in of manythe environment new taxa [12 [2].–15 Recent]. Other studies studies investigate are aiming SRB’s to reveal capability the to possible cause microbial usage of SRB in bio- technology,corrosion and oiltoo, acidification, where SRB which can is be causing used, considerable for example, economic for losses.bioremediation It is worth of toxic com- poundsmentioning in thatthe SRBenvironment inhabit very [12–15]. diverse habitats. Other studies These organisms investigate have SRB’s successfully capability to cause adapted to almost any ecosystem on Earth, from waters to soils and animal guts, humans microbialincluded. SRB corrosion were detected and oil in acidification, both the human whic intestinesh is causing and oral considerable cavity of patients economic losses. withIt is periodontitisworth mentioning [3]. Therefore, that anotherSRB inhabit important very field diverse of study habitats. considering Thes SRBe isorganisms their have suc- potentialcessfully role adapted in inflammatory to almost bowel any diseases ecosystem or periodontitis, on Earth, from as SRB waters produce to hydrogen soils and animal guts, humanssulfide, which included. is toxic toSRB cells were [15–20 detected]. The detail in informationboth the human regarding intestines the metabolism and oral of cavity of pa- SRB, their role in natural processes, or their industrial impacts can be found in the works tients with periodontitis [3]. Therefore, another important field of study considering SRB of R. Rabus, T.A Hansen and F. Widdel [21], J. M. Odom [22] or F. Widdel and F. Bak [23]. isConsidering their potential the wide role range in of inflammatory habitats in which SRBbowel can diseases be found, includingor periodontitis, their possible as SRB produce hydrogenimpact on human sulfide, health which and economics, is toxic to it cells is crucial [15–20]. to study The these detail microorganisms information further. regarding the me- Thetabolism mainpoints of SRB, that their should role be investigatedin natural processes, are the habitats or oftheir this industrial group of organisms, impacts can be found intheir the ecological works of interactions R. Rabus, and T.A finally, Hansen the development and F. Widdel of a broad[21], J. range M. Odom of efficient [22] or F. Widdel methods to reliably detect and identify them in the context of both research and clinical andusage. F. The Bak main [23]. points Considering that will be athe part wide of this range review of are habitats shown in in Figure which2. SRB can be found, in- cluding their possible impact on human health and economics, it is crucial to study these microorganisms further. The main points that should be investigated are the habitats of this group of organisms, their ecological interactions and finally, the development of a broad range of efficient methods to reliably detect and identify them in the context of both research and clinical usage. The main points that will be a part of this review are shown in Figure 2. Int. J. Mol. Sci. 2021, 22, x FOR PEER REVIEW 3 of 27 Int. J. Mol. Sci. 2021, 22, 4007 3 of 27 FigureFigure 2. 2.Main Main points points of the of review. the review. This review aims to describe the ecology and habitats of SRB, their morphology, which can beThis used review in detection aims via to microscopy, describe selected the ecolo moleculargy and methods habitats used toof identify SRB, their morphology, whichthis group, can and
Recommended publications
  • Multiple Lateral Transfers of Dissimilatory Sulfite Reductase

    Multiple Lateral Transfers of Dissimilatory Sulfite Reductase

    JOURNAL OF BACTERIOLOGY, Oct. 2001, p. 6028–6035 Vol. 183, No. 20 0021-9193/01/$04.00ϩ0 DOI: 10.1128/JB.183.20.6028–6035.2001 Copyright © 2001, American Society for Microbiology. All Rights Reserved. Multiple Lateral Transfers of Dissimilatory Sulfite Reductase Genes between Major Lineages of Sulfate-Reducing Prokaryotes MICHAEL KLEIN,1 MICHAEL FRIEDRICH,2 ANDREW J. ROGER,3 PHILIP HUGENHOLTZ,4 SUSAN FISHBAIN,5 1 4 6 1 HEIKE ABICHT, LINDA L. BLACKALL, DAVID A. STAHL, AND MICHAEL WAGNER * 1 Lehrstuhl fu¨r Mikrobiologie, Technische Universita¨t Mu¨nchen, D-85350 Freising, and Department of Biogeochemistry, Max Planck Downloaded from Institute for Terrestrial Microbiology, D-35043-Marburg,2 Germany; Department of Biochemistry and Molecular Biology, Dalhousie University, Halifax, Nova Scotia B3H 4H7, Canada3; Advanced Wastewater Management Centre, Department of Microbiology and Parasitology, The University of Queensland, Brisbane 4072, Queensland, Australia4; Department of Civil Engineering, Northwestern University, Evanston, Illinois 60208-31095; and Department of Civil and Environmental Engineering, University of Washington, Seattle, Washington 98195-27006 Received 26 February 2001/Accepted 3 July 2001 http://jb.asm.org/ A large fragment of the dissimilatory sulfite reductase genes (dsrAB) was PCR amplified and fully sequenced from 30 reference strains representing all recognized lineages of sulfate-reducing bacteria. In addition, the sequence of the dsrAB gene homologs of the sulfite reducer Desulfitobacterium dehalogenans was determined. In contrast to previous reports, comparative analysis of all available DsrAB sequences produced a tree topology partially inconsistent with the corresponding 16S rRNA phylogeny. For example, the DsrAB sequences of -several Desulfotomaculum species (low G؉C gram-positive division) and two members of the genus Thermode sulfobacterium (a separate bacterial division) were monophyletic with ␦-proteobacterial DsrAB sequences.
  • Geomicrobiological Processes in Extreme Environments: a Review

    Geomicrobiological Processes in Extreme Environments: a Review

    202 Articles by Hailiang Dong1, 2 and Bingsong Yu1,3 Geomicrobiological processes in extreme environments: A review 1 Geomicrobiology Laboratory, China University of Geosciences, Beijing, 100083, China. 2 Department of Geology, Miami University, Oxford, OH, 45056, USA. Email: [email protected] 3 School of Earth Sciences, China University of Geosciences, Beijing, 100083, China. The last decade has seen an extraordinary growth of and Mancinelli, 2001). These unique conditions have selected Geomicrobiology. Microorganisms have been studied in unique microorganisms and novel metabolic functions. Readers are directed to recent review papers (Kieft and Phelps, 1997; Pedersen, numerous extreme environments on Earth, ranging from 1997; Krumholz, 2000; Pedersen, 2000; Rothschild and crystalline rocks from the deep subsurface, ancient Mancinelli, 2001; Amend and Teske, 2005; Fredrickson and Balk- sedimentary rocks and hypersaline lakes, to dry deserts will, 2006). A recent study suggests the importance of pressure in the origination of life and biomolecules (Sharma et al., 2002). In and deep-ocean hydrothermal vent systems. In light of this short review and in light of some most recent developments, this recent progress, we review several currently active we focus on two specific aspects: novel metabolic functions and research frontiers: deep continental subsurface micro- energy sources. biology, microbial ecology in saline lakes, microbial Some metabolic functions of continental subsurface formation of dolomite, geomicrobiology in dry deserts, microorganisms fossil DNA and its use in recovery of paleoenviron- Because of the unique geochemical, hydrological, and geological mental conditions, and geomicrobiology of oceans. conditions of the deep subsurface, microorganisms from these envi- Throughout this article we emphasize geomicrobiological ronments are different from surface organisms in their metabolic processes in these extreme environments.
  • Originally Published As

    Originally Published As

    Originally published as: Westphal, A., Lerm, S., Miethling-Graff, R., Seibt, A., Wolfgramm, M., Würdemann, H. (2016): Effects of plant downtime on the microbial community composition in the highly saline brine of a geothermal plant in the North German Basin. - Applied Microbiology and Biotechnology, 100, 7, pp. 3277—3290. DOI: http://doi.org/10.1007/s00253-015-7181-1 1 Effects of plant downtime on the microbial community composition in the highly saline brine 2 of a geothermal plant in the North German Basin 3 4 Anke Westphala, Stephanie Lerma, Rona Miethling-Graffa, Andrea Seibtb, Markus 5 Wolfgrammc, Hilke Würdemannad# 6 7 a GFZ German Research Centre for Geosciences, Section 4.5 Geomicrobiology, 14473 Pots- 8 dam, Germany 9 b BWG Geochemische Beratung GmbH, 17041 Neubrandenburg, Germany 10 c Geothermie Neubrandenburg (GTN), 17041 Neubrandenburg, Germany 11 d Environmental Technology, Water- and Recycling Technology, Department of Engineering 12 and Natural Sciences, University of Applied Sciences Merseburg, 06217 Merseburg, Germa- 13 ny 14 15 16 17 18 19 20 21 22 23 24 # Address correspondence to Hilke Würdemann 25 [email protected] 26 Phone: +49 331 288 1516 27 Fax: ++49 331 2300662 1 28 Abstract 29 The microbial biocenosis in highly saline fluids produced from the cold well of a deep geo- 30 thermal heat store located in the North German Basin was characterized during regular plant 31 operation and immediately after plant downtime phases. Genetic fingerprinting revealed the 32 dominance of sulfate-reducing bacteria (SRB) and fermentative Halanaerobiaceae during 33 regular plant operation, whereas after shut-down phases, sequences of sulfur-oxidizing bacte- 34 ria (SOB) were also detected.
  • Supplementary Information for Microbial Electrochemical Systems Outperform Fixed-Bed Biofilters for Cleaning-Up Urban Wastewater

    Supplementary Information for Microbial Electrochemical Systems Outperform Fixed-Bed Biofilters for Cleaning-Up Urban Wastewater

    Electronic Supplementary Material (ESI) for Environmental Science: Water Research & Technology. This journal is © The Royal Society of Chemistry 2016 Supplementary information for Microbial Electrochemical Systems outperform fixed-bed biofilters for cleaning-up urban wastewater AUTHORS: Arantxa Aguirre-Sierraa, Tristano Bacchetti De Gregorisb, Antonio Berná, Juan José Salasc, Carlos Aragónc, Abraham Esteve-Núñezab* Fig.1S Total nitrogen (A), ammonia (B) and nitrate (C) influent and effluent average values of the coke and the gravel biofilters. Error bars represent 95% confidence interval. Fig. 2S Influent and effluent COD (A) and BOD5 (B) average values of the hybrid biofilter and the hybrid polarized biofilter. Error bars represent 95% confidence interval. Fig. 3S Redox potential measured in the coke and the gravel biofilters Fig. 4S Rarefaction curves calculated for each sample based on the OTU computations. Fig. 5S Correspondence analysis biplot of classes’ distribution from pyrosequencing analysis. Fig. 6S. Relative abundance of classes of the category ‘other’ at class level. Table 1S Influent pre-treated wastewater and effluents characteristics. Averages ± SD HRT (d) 4.0 3.4 1.7 0.8 0.5 Influent COD (mg L-1) 246 ± 114 330 ± 107 457 ± 92 318 ± 143 393 ± 101 -1 BOD5 (mg L ) 136 ± 86 235 ± 36 268 ± 81 176 ± 127 213 ± 112 TN (mg L-1) 45.0 ± 17.4 60.6 ± 7.5 57.7 ± 3.9 43.7 ± 16.5 54.8 ± 10.1 -1 NH4-N (mg L ) 32.7 ± 18.7 51.6 ± 6.5 49.0 ± 2.3 36.6 ± 15.9 47.0 ± 8.8 -1 NO3-N (mg L ) 2.3 ± 3.6 1.0 ± 1.6 0.8 ± 0.6 1.5 ± 2.0 0.9 ± 0.6 TP (mg
  • The Gut Microbiome of the Sea Urchin, Lytechinus Variegatus, from Its Natural Habitat Demonstrates Selective Attributes of Micro

    The Gut Microbiome of the Sea Urchin, Lytechinus Variegatus, from Its Natural Habitat Demonstrates Selective Attributes of Micro

    FEMS Microbiology Ecology, 92, 2016, fiw146 doi: 10.1093/femsec/fiw146 Advance Access Publication Date: 1 July 2016 Research Article RESEARCH ARTICLE The gut microbiome of the sea urchin, Lytechinus variegatus, from its natural habitat demonstrates selective attributes of microbial taxa and predictive metabolic profiles Joseph A. Hakim1,†, Hyunmin Koo1,†, Ranjit Kumar2, Elliot J. Lefkowitz2,3, Casey D. Morrow4, Mickie L. Powell1, Stephen A. Watts1,∗ and Asim K. Bej1,∗ 1Department of Biology, University of Alabama at Birmingham, 1300 University Blvd, Birmingham, AL 35294, USA, 2Center for Clinical and Translational Sciences, University of Alabama at Birmingham, Birmingham, AL 35294, USA, 3Department of Microbiology, University of Alabama at Birmingham, Birmingham, AL 35294, USA and 4Department of Cell, Developmental and Integrative Biology, University of Alabama at Birmingham, 1918 University Blvd., Birmingham, AL 35294, USA ∗Corresponding authors: Department of Biology, University of Alabama at Birmingham, 1300 University Blvd, CH464, Birmingham, AL 35294-1170, USA. Tel: +1-(205)-934-8308; Fax: +1-(205)-975-6097; E-mail: [email protected]; [email protected] †These authors contributed equally to this work. One sentence summary: This study describes the distribution of microbiota, and their predicted functional attributes, in the gut ecosystem of sea urchin, Lytechinus variegatus, from its natural habitat of Gulf of Mexico. Editor: Julian Marchesi ABSTRACT In this paper, we describe the microbial composition and their predictive metabolic profile in the sea urchin Lytechinus variegatus gut ecosystem along with samples from its habitat by using NextGen amplicon sequencing and downstream bioinformatics analyses. The microbial communities of the gut tissue revealed a near-exclusive abundance of Campylobacteraceae, whereas the pharynx tissue consisted of Tenericutes, followed by Gamma-, Alpha- and Epsilonproteobacteria at approximately equal capacities.
  • Differences in Lateral Gene Transfer in Hypersaline Versus Thermal Environments Matthew E Rhodes1*, John R Spear2, Aharon Oren3 and Christopher H House1

    Differences in Lateral Gene Transfer in Hypersaline Versus Thermal Environments Matthew E Rhodes1*, John R Spear2, Aharon Oren3 and Christopher H House1

    Rhodes et al. BMC Evolutionary Biology 2011, 11:199 http://www.biomedcentral.com/1471-2148/11/199 RESEARCH ARTICLE Open Access Differences in lateral gene transfer in hypersaline versus thermal environments Matthew E Rhodes1*, John R Spear2, Aharon Oren3 and Christopher H House1 Abstract Background: The role of lateral gene transfer (LGT) in the evolution of microorganisms is only beginning to be understood. While most LGT events occur between closely related individuals, inter-phylum and inter-domain LGT events are not uncommon. These distant transfer events offer potentially greater fitness advantages and it is for this reason that these “long distance” LGT events may have significantly impacted the evolution of microbes. One mechanism driving distant LGT events is microbial transformation. Theoretically, transformative events can occur between any two species provided that the DNA of one enters the habitat of the other. Two categories of microorganisms that are well-known for LGT are the thermophiles and halophiles. Results: We identified potential inter-class LGT events into both a thermophilic class of Archaea (Thermoprotei) and a halophilic class of Archaea (Halobacteria). We then categorized these LGT genes as originating in thermophiles and halophiles respectively. While more than 68% of transfer events into Thermoprotei taxa originated in other thermophiles, less than 11% of transfer events into Halobacteria taxa originated in other halophiles. Conclusions: Our results suggest that there is a fundamental difference between LGT in thermophiles and halophiles. We theorize that the difference lies in the different natures of the environments. While DNA degrades rapidly in thermal environments due to temperature-driven denaturization, hypersaline environments are adept at preserving DNA.
  • Orthologs of the Small RPB8 Subunit of the Eukaryotic RNA Polymerases

    Orthologs of the Small RPB8 Subunit of the Eukaryotic RNA Polymerases

    Biology Direct BioMed Central Discovery notes Open Access Orthologs of the small RPB8 subunit of the eukaryotic RNA polymerases are conserved in hyperthermophilic Crenarchaeota and "Korarchaeota" Eugene V Koonin*1, Kira S Makarova1 and James G Elkins2 Address: 1National Center for Biotechnology Information, National Library of Medicine, National Institutes of Health, Bethesda, MD 20894, USA and 2Microbial Ecology and Physiology Group, Biosciences Division, Oak Ridge National Laboratory, Oak Ridge, TN 37831, USA Email: Eugene V Koonin* - [email protected]; Kira S Makarova - [email protected]; James G Elkins - [email protected] * Corresponding author Published: 14 December 2007 Received: 13 December 2007 Accepted: 14 December 2007 Biology Direct 2007, 2:38 doi:10.1186/1745-6150-2-38 This article is available from: http://www.biology-direct.com/content/2/1/38 © 2007 Koonin et al; licensee BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Abstract : Although most of the key components of the transcription apparatus, and in particular, RNA polymerase (RNAP) subunits, are conserved between archaea and eukaryotes, no archaeal homologs of the small RPB8 subunit of eukaryotic RNAP have been detected. We report that orthologs of RPB8 are encoded in all sequenced genomes of hyperthermophilic Crenarchaeota and a recently sequenced "korarchaeal" genome, but not in Euryarchaeota or the mesophilic crenarchaeon Cenarchaeum symbiosum. These findings suggest that all 12 core subunits of eukaryotic RNAPs were already present in the last common ancestor of the extant archaea.
  • The Eastern Nebraska Salt Marsh Microbiome Is Well Adapted to an Alkaline and Extreme Saline Environment

    The Eastern Nebraska Salt Marsh Microbiome Is Well Adapted to an Alkaline and Extreme Saline Environment

    life Article The Eastern Nebraska Salt Marsh Microbiome Is Well Adapted to an Alkaline and Extreme Saline Environment Sierra R. Athen, Shivangi Dubey and John A. Kyndt * College of Science and Technology, Bellevue University, Bellevue, NE 68005, USA; [email protected] (S.R.A.); [email protected] (S.D.) * Correspondence: [email protected] Abstract: The Eastern Nebraska Salt Marshes contain a unique, alkaline, and saline wetland area that is a remnant of prehistoric oceans that once covered this area. The microbial composition of these salt marshes, identified by metagenomic sequencing, appears to be different from well-studied coastal salt marshes as it contains bacterial genera that have only been found in cold-adapted, alkaline, saline environments. For example, Rubribacterium was only isolated before from an Eastern Siberian soda lake, but appears to be one of the most abundant bacteria present at the time of sampling of the Eastern Nebraska Salt Marshes. Further enrichment, followed by genome sequencing and metagenomic binning, revealed the presence of several halophilic, alkalophilic bacteria that play important roles in sulfur and carbon cycling, as well as in nitrogen fixation within this ecosystem. Photosynthetic sulfur bacteria, belonging to Prosthecochloris and Marichromatium, and chemotrophic sulfur bacteria of the genera Sulfurimonas, Arcobacter, and Thiomicrospira produce valuable oxidized sulfur compounds for algal and plant growth, while alkaliphilic, sulfur-reducing bacteria belonging to Sulfurospirillum help balance the sulfur cycle. This metagenome-based study provides a baseline to understand the complex, but balanced, syntrophic microbial interactions that occur in this unique Citation: Athen, S.R.; Dubey, S.; inland salt marsh environment.
  • Pila Genes. the Location of Alpha Helices (Represented by Red H) and Beta Strands (Represented by Yellow E) Was Predicted with Jpred 4 (Drozdetskiy Et Al, 2015)

    Pila Genes. the Location of Alpha Helices (Represented by Red H) and Beta Strands (Represented by Yellow E) Was Predicted with Jpred 4 (Drozdetskiy Et Al, 2015)

    Supplementary Figure S1. Secondary structure of the N-terminus of PilA proteins from Desulfuromondales species and other bacteria that possess type IVa pilA genes. The location of alpha helices (represented by red H) and beta strands (represented by yellow E) was predicted with Jpred 4 (Drozdetskiy et al, 2015). Transmembrane helices (green background) were predicted with TmPred (Hofmann & Stoffel, 1993), TMHMM (Krogh et al, 2001), and HMMTOP (Tusnady & Simon, 2001). G. bemidjiensis (Gbem_2590) MLNKLRSNKGFTLIELLIVVAIIGILAAIAIPQFSAYREKAYNAASNSDLKNFKTGLEAFNADFQTYPAAYVASTN ---HHH----HHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHH-----HHHHHHHHHH-------EEEE--- G. bremensis (K419DRAFT_00801) MLNKLRSNKGFTLIELLIVVAIIGILAAIAIPQFSAYREKAYNAASNSDLKNWKTGQEAYQADFQAYPAAYDVH --HHHH----HHHHHHHHHHHHHHHHHHH----HHHHHHHHHH------HHHHHHHHHHHHHHH---------- Pelobacter seleniigenes (N909DRAFT_0006) MLKKFRKNEKGFTLIELLIVVAIIGILAAIAIPQFASYRQKAFNSASQSDLKTIKTSLEGYYTDEYYYPY --HHHHH-----HHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHH------- Geobacter sp. OR-1 (WP_041974243) MLSKLRSNKGFTLIELLIVVAIIGILAAIAIPQFSAYREKAYNTAANADDKNAKTGEEAYNADNQKYPLAYDQH --HHHHH----HHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHH------------ Geobacter sp. M18 (GM18_2492) MLNKIRSNKGFTLIELLIVVAIIGILAAIAIPQFSAYRAKAYNAAANSDLKNIKTGMEAYMADRQAYPVSLDER --HHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------------ Geobacter sp. M21 MLNKLRSNKGFTLIELLIVVAIIGILAAIAIPQFSAYRAKAYNSAANSDLKNMKTGMEAYMADRQAYPALLDQR --HHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----------- Desulfuromonas
  • Distribution of Sulfate-Reducing Communities from Estuarine to Marine Bay Waters Yannick Colin, M

    Distribution of Sulfate-Reducing Communities from Estuarine to Marine Bay Waters Yannick Colin, M

    Distribution of Sulfate-Reducing Communities from Estuarine to Marine Bay Waters Yannick Colin, M. Goñi-Urriza, C. Gassie, E. Carlier, M. Monperrus, R. Guyoneaud To cite this version: Yannick Colin, M. Goñi-Urriza, C. Gassie, E. Carlier, M. Monperrus, et al.. Distribution of Sulfate- Reducing Communities from Estuarine to Marine Bay Waters. Microbial Ecology, Springer Verlag, 2017, 73 (1), pp.39-49. 10.1007/s00248-016-0842-5. hal-01499135 HAL Id: hal-01499135 https://hal.archives-ouvertes.fr/hal-01499135 Submitted on 26 Sep 2017 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Distributed under a Creative Commons Attribution - ShareAlike| 4.0 International License Microb Ecol (2017) 73:39–49 DOI 10.1007/s00248-016-0842-5 MICROBIOLOGY OF AQUATIC SYSTEMS Distribution of Sulfate-Reducing Communities from Estuarine to Marine Bay Waters Yannick Colin 1,2 & Marisol Goñi-Urriza1 & Claire Gassie1 & Elisabeth Carlier 1 & Mathilde Monperrus3 & Rémy Guyoneaud1 Received: 23 May 2016 /Accepted: 17 August 2016 /Published online: 31 August 2016 # Springer Science+Business Media New York 2016 Abstract Estuaries are highly dynamic ecosystems in which gradient. The concentration of cultured sulfidogenic microor- freshwater and seawater mix together.
  • Impacts of Desulfobacterales and Chromatiales on Sulfate Reduction in The

    Impacts of Desulfobacterales and Chromatiales on Sulfate Reduction in The

    bioRxiv preprint doi: https://doi.org/10.1101/2020.08.16.252635; this version posted November 6, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 1 Impacts of Desulfobacterales and Chromatiales on sulfate reduction in the 2 subtropical mangrove ecosystem as revealed by SMDB analysis 3 Shuming Mo 1, †, Jinhui Li 1, †, Bin Li 2, Ran Yu 1, Shiqing Nie 1, Zufan Zhang 1, Jianping 4 Liao 3, Qiong Jiang 1, Bing Yan 2, *, and Chengjian Jiang 1, 2 * 5 1 State Key Laboratory for Conservation and Utilization of Subtropical Agro- 6 bioresources, Guangxi Research Center for Microbial and Enzyme Engineering 7 Technology, College of Life Science and Technology, Guangxi University, Nanning 8 530004, China. 9 2 Guangxi Key Lab of Mangrove Conservation and Utilization, Guangxi Mangrove 10 Research Center, Guangxi Academy of Sciences, Beihai 536000, China. 11 3 School of Computer and Information Engineering, Nanning Normal University, 12 Nanning 530299, China. 13 † These authors contributed equally to this work. 14 *: Corresponding Author: 15 Tel: +86-771-3270736; Fax: +86-771-3237873 16 Email: [email protected] (CJ); [email protected] (BY) 17 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.08.16.252635; this version posted November 6, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity.
  • High Diversity of Anaerobic Alkane-Degrading Microbial Communities in Marine Seep Sediments Based on (1-Methylalkyl)Succinate Synthase Genes

    High Diversity of Anaerobic Alkane-Degrading Microbial Communities in Marine Seep Sediments Based on (1-Methylalkyl)Succinate Synthase Genes

    ORIGINAL RESEARCH published: 07 January 2016 doi: 10.3389/fmicb.2015.01511 High Diversity of Anaerobic Alkane-Degrading Microbial Communities in Marine Seep Sediments Based on (1-methylalkyl)succinate Synthase Genes Marion H. Stagars1,S.EmilRuff1,2† , Rudolf Amann1 and Katrin Knittel1* 1 Department of Molecular Ecology, Max Planck Institute for Marine Microbiology, Bremen, Germany, 2 HGF MPG Joint Research Group for Deep-Sea Ecology and Technology, Max Planck Institute for Marine Microbiology, Bremen, Germany Edited by: Alkanes comprise a substantial fraction of crude oil and are prevalent at marine seeps. Hans H. Richnow, These environments are typically anoxic and host diverse microbial communities that Helmholtz Centre for Environmental Research, Germany grow on alkanes. The most widely distributed mechanism of anaerobic alkane activation Reviewed by: is the addition of alkanes to fumarate by (1-methylalkyl)succinate synthase (Mas). Here Beth Orcutt, we studied the diversity of MasD, the catalytic subunit of the enzyme, in 12 marine Bigelow Laboratory for Ocean sediments sampled at seven seeps. We aimed to identify cosmopolitan species as well Sciences, USA Zhidan Liu, as to identify factors structuring the alkane-degrading community. Using next generation China Agricultural University, China sequencing we obtained a total of 420 MasD species-level operational taxonomic units *Correspondence: (OTU0.96) at 96% amino acid identity. Diversity analysis shows a high richness and Katrin Knittel [email protected] evenness of alkane-degrading bacteria. Sites with similar hydrocarbon composition harbored similar alkane-degrading communities based on MasD genes; the MasD †Present address: community structure is clearly driven by the hydrocarbon source available at the various S.