Characterization of Olkiluoto Bacterial and Archaeal Communities by 454 Pyrosequencing
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Heavy Metal and Sulfate Tolerance Bacteria Isolated from the Mine Drainage and Sediment of Igun, Osun State, Nigeria
IOSR Journal of Environmental Science, Toxicology and Food Technology (IOSR-JESTFT) e-ISSN: 2319-2402,p- ISSN: 2319-2399.Volume 15, Issue 3 Ser. I (March 2021), PP 36-55 www.iosrjournals.org Heavy Metal and Sulfate Tolerance Bacteria Isolated from the Mine Drainage and Sediment of Igun, Osun State, Nigeria Aransiola M. N.1 Olusola B. O.2 and Fagade O. E.1 1(Department of Microbiology, Faculty of Science, University of Ibadan, Ibadan, Nigeria) 2(Department of Health Sciences, College of Health Professions, Walden University, Minneapolis, USA) Abstract Background: Mine Drainages (MD) are polluted water associated with mining activities which may contain heavy metals and other chemicals which impact biotic and abiotic factors of such environment. Igun area is known for abandoned mine site with MD. Therefore, the objectives of this study are to determine the physicochemical and microbiological properties of an abandoned mine water and sediment at Igun, and evaluate the heavy metals and sulfate ion tolerance of the indigenous bacteria. Materials and Methods: The Igun MD was divided into grids (4x4 m2) and from each grid, water and sediment sample s were purposively collected in February and October of 2014 to 2016. The chemical analyses of the samples were carried out using APHA methods and compared with the NESREA’s recommendation. Microbial analyses of the samples were done using cultural, phenotypic and genomic characteristics to determine the Aerobic Bacteria (AB) and Sulfate Reducing Bacteria (SRB) within the Igun MD. The isolated bacteria were screened for heavy metal and sulfate tolerance using standard methods. Data were analysed using descriptive statistics. -
Geomicrobiological Processes in Extreme Environments: a Review
202 Articles by Hailiang Dong1, 2 and Bingsong Yu1,3 Geomicrobiological processes in extreme environments: A review 1 Geomicrobiology Laboratory, China University of Geosciences, Beijing, 100083, China. 2 Department of Geology, Miami University, Oxford, OH, 45056, USA. Email: [email protected] 3 School of Earth Sciences, China University of Geosciences, Beijing, 100083, China. The last decade has seen an extraordinary growth of and Mancinelli, 2001). These unique conditions have selected Geomicrobiology. Microorganisms have been studied in unique microorganisms and novel metabolic functions. Readers are directed to recent review papers (Kieft and Phelps, 1997; Pedersen, numerous extreme environments on Earth, ranging from 1997; Krumholz, 2000; Pedersen, 2000; Rothschild and crystalline rocks from the deep subsurface, ancient Mancinelli, 2001; Amend and Teske, 2005; Fredrickson and Balk- sedimentary rocks and hypersaline lakes, to dry deserts will, 2006). A recent study suggests the importance of pressure in the origination of life and biomolecules (Sharma et al., 2002). In and deep-ocean hydrothermal vent systems. In light of this short review and in light of some most recent developments, this recent progress, we review several currently active we focus on two specific aspects: novel metabolic functions and research frontiers: deep continental subsurface micro- energy sources. biology, microbial ecology in saline lakes, microbial Some metabolic functions of continental subsurface formation of dolomite, geomicrobiology in dry deserts, microorganisms fossil DNA and its use in recovery of paleoenviron- Because of the unique geochemical, hydrological, and geological mental conditions, and geomicrobiology of oceans. conditions of the deep subsurface, microorganisms from these envi- Throughout this article we emphasize geomicrobiological ronments are different from surface organisms in their metabolic processes in these extreme environments. -
Insights Into Archaeal Evolution and Symbiosis from the Genomes of a Nanoarchaeon and Its Inferred Crenarchaeal Host from Obsidian Pool, Yellowstone National Park
University of Tennessee, Knoxville TRACE: Tennessee Research and Creative Exchange Microbiology Publications and Other Works Microbiology 4-22-2013 Insights into archaeal evolution and symbiosis from the genomes of a nanoarchaeon and its inferred crenarchaeal host from Obsidian Pool, Yellowstone National Park Mircea Podar University of Tennessee - Knoxville, [email protected] Kira S. Makarova National Institutes of Health David E. Graham University of Tennessee - Knoxville, [email protected] Yuri I. Wolf National Institutes of Health Eugene V. Koonin National Institutes of Health See next page for additional authors Follow this and additional works at: https://trace.tennessee.edu/utk_micrpubs Part of the Microbiology Commons Recommended Citation Biology Direct 2013, 8:9 doi:10.1186/1745-6150-8-9 This Article is brought to you for free and open access by the Microbiology at TRACE: Tennessee Research and Creative Exchange. It has been accepted for inclusion in Microbiology Publications and Other Works by an authorized administrator of TRACE: Tennessee Research and Creative Exchange. For more information, please contact [email protected]. Authors Mircea Podar, Kira S. Makarova, David E. Graham, Yuri I. Wolf, Eugene V. Koonin, and Anna-Louise Reysenbach This article is available at TRACE: Tennessee Research and Creative Exchange: https://trace.tennessee.edu/ utk_micrpubs/44 Podar et al. Biology Direct 2013, 8:9 http://www.biology-direct.com/content/8/1/9 RESEARCH Open Access Insights into archaeal evolution and symbiosis from the genomes of a nanoarchaeon and its inferred crenarchaeal host from Obsidian Pool, Yellowstone National Park Mircea Podar1,2*, Kira S Makarova3, David E Graham1,2, Yuri I Wolf3, Eugene V Koonin3 and Anna-Louise Reysenbach4 Abstract Background: A single cultured marine organism, Nanoarchaeum equitans, represents the Nanoarchaeota branch of symbiotic Archaea, with a highly reduced genome and unusual features such as multiple split genes. -
Brian W. Waters
INVESTIGATION OF 2-OXOACID OXIDOREDUCTASES IN METHANOCOCCUS MARIPALUDIS AND LARGE-SCALE GROWTH OF M. MARIPALUDIS by BRIAN W. WATERS (Under the direction of Dr. William B. Whitman) ABSTRACT With the emergence of Methanococcus maripaludis as a genetic model for methanogens, it becomes imperative to devise inexpensive yet effective ways to grow large numbers of cells for protein studies. Chapter 2 details methods that were used to cut costs of growing M. maripaludis in large scale. Also, large scale growth under different conditions was explored in order to find the conditions that yield the most cells. Chapter 3 details the phylogenetic analysis of 2-oxoacid oxidoreductase (OR) homologs from M. maripaludis. ORs are enzymes that catalyze the oxidative decarboxylation of 2-oxoacids to their acyl-CoA derivatives in many prokaryotes. Also in chapter 3, a specific OR homolog in M. maripaludis, an indolepyruvate oxidoreductase (IOR), was mutagenized, and the mutant was characterized. PCR and Southern hybridization analysis showed gene replacement. A no-growth phenotype on media containing aromatic amino acid derivatives was found. INDEX WORDS: Methanococcus maripaludis, fermentor, 2-oxoacid oxidoreductase, indolepyruvate oxidoreductase INVESTIGATION OF 2-OXOACID OXIDOREDUCTASES IN METHANOCOCCUS MARIPALUDIS AND LARGE-SCALE GROWTH OF M. MARIPALUDIS by BRIAN W. WATERS B.S., The University of Georgia,1999 A Thesis Submitted to the Graduate Faculty of The University of Georgia in Partial Fulfillment of the Requirements for the Degree MASTER OF SCIENCE ATHENS, GEORGIA 2002 © 2002 Brian W. Waters All Rights Reserved INVESTIGATION OF 2-OXOACID OXIDOREDUCTASES IN METHANOCOCCUS MARIPALUDIS AND LARGE-SCALE GROWTH OF M. MARIPALUDIS by BRIAN W. -
University of Oklahoma Graduate College Microbial Ecology of Coastal Ecosystems: Investigations of the Genetic Potential For
UNIVERSITY OF OKLAHOMA GRADUATE COLLEGE MICROBIAL ECOLOGY OF COASTAL ECOSYSTEMS: INVESTIGATIONS OF THE GENETIC POTENTIAL FOR ANAEROBIC HYDROCARBON TRANSFORMATION AND THE RESPONSE TO HYDROCARBON EXPOSURE A DISSERTATION SUBMITTED TO THE GRADUATE FACULTY in partial fulfillment of the requirements of the Degree of DOCTOR OF PHILOSOPHY By JAMIE M. JOHNSON DUFFNER Norman, Oklahoma 2017 MICROBIAL ECOLOGY OF COASTAL ECOSYSTEMS: INVESTIGATIONS OF THE GENETIC POTENTIAL FOR ANAEROBIC HYDROCARBON TRANSFORMATION AND THE RESPONSE TO HYDROCARBON EXPOSURE A DISSERTATION APPROVED FOR THE DEPARTMENT OF MICROBIOLOGY AND PLANT BIOLOGY BY ______________________________ Dr. Amy V. Callaghan, Chair ______________________________ Dr. Lee R. Krumholz ______________________________ Dr. Michael J. McInerney ______________________________ Dr. Mark A. Nanny ______________________________ Dr. Boris Wawrik © Copyright by JAMIE M. JOHNSON DUFFNER 2017 All Rights Reserved. This dissertation is dedicated to my husband, Derick, for his unwavering love and support. Acknowledgements I would like to thank my advisor, Dr. Amy Callaghan, for her guidance and support during my time as a graduate student, as well as for her commitment to my success as a scientist. I would also like to thank the members of my doctoral committee for their guidance over the years, particularly that of Dr. Boris Wawrik. I would like to also thank Drs. Josh Cooper, Chris Lyles, and Chris Marks for their friendship and support during my time at OU, both in and outside the lab. iv Table of Contents -
Pila Genes. the Location of Alpha Helices (Represented by Red H) and Beta Strands (Represented by Yellow E) Was Predicted with Jpred 4 (Drozdetskiy Et Al, 2015)
Supplementary Figure S1. Secondary structure of the N-terminus of PilA proteins from Desulfuromondales species and other bacteria that possess type IVa pilA genes. The location of alpha helices (represented by red H) and beta strands (represented by yellow E) was predicted with Jpred 4 (Drozdetskiy et al, 2015). Transmembrane helices (green background) were predicted with TmPred (Hofmann & Stoffel, 1993), TMHMM (Krogh et al, 2001), and HMMTOP (Tusnady & Simon, 2001). G. bemidjiensis (Gbem_2590) MLNKLRSNKGFTLIELLIVVAIIGILAAIAIPQFSAYREKAYNAASNSDLKNFKTGLEAFNADFQTYPAAYVASTN ---HHH----HHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHH-----HHHHHHHHHH-------EEEE--- G. bremensis (K419DRAFT_00801) MLNKLRSNKGFTLIELLIVVAIIGILAAIAIPQFSAYREKAYNAASNSDLKNWKTGQEAYQADFQAYPAAYDVH --HHHH----HHHHHHHHHHHHHHHHHHH----HHHHHHHHHH------HHHHHHHHHHHHHHH---------- Pelobacter seleniigenes (N909DRAFT_0006) MLKKFRKNEKGFTLIELLIVVAIIGILAAIAIPQFASYRQKAFNSASQSDLKTIKTSLEGYYTDEYYYPY --HHHHH-----HHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHH------- Geobacter sp. OR-1 (WP_041974243) MLSKLRSNKGFTLIELLIVVAIIGILAAIAIPQFSAYREKAYNTAANADDKNAKTGEEAYNADNQKYPLAYDQH --HHHHH----HHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHH------------ Geobacter sp. M18 (GM18_2492) MLNKIRSNKGFTLIELLIVVAIIGILAAIAIPQFSAYRAKAYNAAANSDLKNIKTGMEAYMADRQAYPVSLDER --HHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------------ Geobacter sp. M21 MLNKLRSNKGFTLIELLIVVAIIGILAAIAIPQFSAYRAKAYNSAANSDLKNMKTGMEAYMADRQAYPALLDQR --HHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----------- Desulfuromonas -
Distribution of Sulfate-Reducing Communities from Estuarine to Marine Bay Waters Yannick Colin, M
Distribution of Sulfate-Reducing Communities from Estuarine to Marine Bay Waters Yannick Colin, M. Goñi-Urriza, C. Gassie, E. Carlier, M. Monperrus, R. Guyoneaud To cite this version: Yannick Colin, M. Goñi-Urriza, C. Gassie, E. Carlier, M. Monperrus, et al.. Distribution of Sulfate- Reducing Communities from Estuarine to Marine Bay Waters. Microbial Ecology, Springer Verlag, 2017, 73 (1), pp.39-49. 10.1007/s00248-016-0842-5. hal-01499135 HAL Id: hal-01499135 https://hal.archives-ouvertes.fr/hal-01499135 Submitted on 26 Sep 2017 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Distributed under a Creative Commons Attribution - ShareAlike| 4.0 International License Microb Ecol (2017) 73:39–49 DOI 10.1007/s00248-016-0842-5 MICROBIOLOGY OF AQUATIC SYSTEMS Distribution of Sulfate-Reducing Communities from Estuarine to Marine Bay Waters Yannick Colin 1,2 & Marisol Goñi-Urriza1 & Claire Gassie1 & Elisabeth Carlier 1 & Mathilde Monperrus3 & Rémy Guyoneaud1 Received: 23 May 2016 /Accepted: 17 August 2016 /Published online: 31 August 2016 # Springer Science+Business Media New York 2016 Abstract Estuaries are highly dynamic ecosystems in which gradient. The concentration of cultured sulfidogenic microor- freshwater and seawater mix together. -
Phylogenetic and Functional Characterization of Symbiotic Bacteria in Gutless Marine Worms (Annelida, Oligochaeta)
Phylogenetic and functional characterization of symbiotic bacteria in gutless marine worms (Annelida, Oligochaeta) Dissertation zur Erlangung des Grades eines Doktors der Naturwissenschaften -Dr. rer. nat.- dem Fachbereich Biologie/Chemie der Universität Bremen vorgelegt von Anna Blazejak Oktober 2005 Die vorliegende Arbeit wurde in der Zeit vom März 2002 bis Oktober 2005 am Max-Planck-Institut für Marine Mikrobiologie in Bremen angefertigt. 1. Gutachter: Prof. Dr. Rudolf Amann 2. Gutachter: Prof. Dr. Ulrich Fischer Tag des Promotionskolloquiums: 22. November 2005 Contents Summary ………………………………………………………………………………….… 1 Zusammenfassung ………………………………………………………………………… 2 Part I: Combined Presentation of Results A Introduction .…………………………………………………………………… 4 1 Definition and characteristics of symbiosis ...……………………………………. 4 2 Chemoautotrophic symbioses ..…………………………………………………… 6 2.1 Habitats of chemoautotrophic symbioses .………………………………… 8 2.2 Diversity of hosts harboring chemoautotrophic bacteria ………………… 10 2.2.1 Phylogenetic diversity of chemoautotrophic symbionts …………… 11 3 Symbiotic associations in gutless oligochaetes ………………………………… 13 3.1 Biogeography and phylogeny of the hosts …..……………………………. 13 3.2 The environment …..…………………………………………………………. 14 3.3 Structure of the symbiosis ………..…………………………………………. 16 3.4 Transmission of the symbionts ………..……………………………………. 18 3.5 Molecular characterization of the symbionts …..………………………….. 19 3.6 Function of the symbionts in gutless oligochaetes ..…..…………………. 20 4 Goals of this thesis …….………………………………………………………….. -
1 Characterization of Sulfur Metabolizing Microbes in a Cold Saline Microbial Mat of the Canadian High Arctic Raven Comery Mast
Characterization of sulfur metabolizing microbes in a cold saline microbial mat of the Canadian High Arctic Raven Comery Master of Science Department of Natural Resource Sciences Unit: Microbiology McGill University, Montreal July 2015 A thesis submitted to McGill University in partial fulfillment of the requirements of the degree of Master in Science © Raven Comery 2015 1 Abstract/Résumé The Gypsum Hill (GH) spring system is located on Axel Heiberg Island of the High Arctic, perennially discharging cold hypersaline water rich in sulfur compounds. Microbial mats are found adjacent to channels of the GH springs. This thesis is the first detailed analysis of the Gypsum Hill spring microbial mats and their microbial diversity. Physicochemical analyses of the water saturating the GH spring microbial mat show that in summer it is cold (9°C), hypersaline (5.6%), and contains sulfide (0-10 ppm) and thiosulfate (>50 ppm). Pyrosequencing analyses were carried out on both 16S rRNA transcripts (i.e. cDNA) and genes (i.e. DNA) to investigate the mat’s community composition, diversity, and putatively active members. In order to investigate the sulfate reducing community in detail, the sulfite reductase gene and its transcript were also sequenced. Finally, enrichment cultures for sulfate/sulfur reducing bacteria were set up and monitored for sulfide production at cold temperatures. Overall, sulfur metabolism was found to be an important component of the GH microbial mat system, particularly the active fraction, as 49% of DNA and 77% of cDNA from bacterial 16S rRNA gene libraries were classified as taxa capable of the reduction or oxidation of sulfur compounds. -
High Diversity of Anaerobic Alkane-Degrading Microbial Communities in Marine Seep Sediments Based on (1-Methylalkyl)Succinate Synthase Genes
ORIGINAL RESEARCH published: 07 January 2016 doi: 10.3389/fmicb.2015.01511 High Diversity of Anaerobic Alkane-Degrading Microbial Communities in Marine Seep Sediments Based on (1-methylalkyl)succinate Synthase Genes Marion H. Stagars1,S.EmilRuff1,2† , Rudolf Amann1 and Katrin Knittel1* 1 Department of Molecular Ecology, Max Planck Institute for Marine Microbiology, Bremen, Germany, 2 HGF MPG Joint Research Group for Deep-Sea Ecology and Technology, Max Planck Institute for Marine Microbiology, Bremen, Germany Edited by: Alkanes comprise a substantial fraction of crude oil and are prevalent at marine seeps. Hans H. Richnow, These environments are typically anoxic and host diverse microbial communities that Helmholtz Centre for Environmental Research, Germany grow on alkanes. The most widely distributed mechanism of anaerobic alkane activation Reviewed by: is the addition of alkanes to fumarate by (1-methylalkyl)succinate synthase (Mas). Here Beth Orcutt, we studied the diversity of MasD, the catalytic subunit of the enzyme, in 12 marine Bigelow Laboratory for Ocean sediments sampled at seven seeps. We aimed to identify cosmopolitan species as well Sciences, USA Zhidan Liu, as to identify factors structuring the alkane-degrading community. Using next generation China Agricultural University, China sequencing we obtained a total of 420 MasD species-level operational taxonomic units *Correspondence: (OTU0.96) at 96% amino acid identity. Diversity analysis shows a high richness and Katrin Knittel [email protected] evenness of alkane-degrading bacteria. Sites with similar hydrocarbon composition harbored similar alkane-degrading communities based on MasD genes; the MasD †Present address: community structure is clearly driven by the hydrocarbon source available at the various S. -
Fmicb-08-02642
Edinburgh Research Explorer Identification, Comparison, and Validation of Robust Rumen Microbial Biomarkers for Methane Emissions Using DiverseBreeds and Basal Diets Citation for published version: Auffret, MD, Stewart, R, Dewhurst, R, Duthie, C-A, Rooke, JA, Wallace, R, Freeman, T, Snelling, TJ, Watson, M & Roehe, R 2018, 'Identification, Comparison, and Validation of Robust Rumen Microbial Biomarkers for Methane Emissions Using DiverseBreeds and Basal Diets', Frontiers in Microbiology, vol. 8, 2642. https://doi.org/10.3389/fmicb.2017.02642, https://doi.org/10.3389/fmicb.2017.02642 Digital Object Identifier (DOI): 10.3389/fmicb.2017.02642 10.3389/fmicb.2017.02642 Link: Link to publication record in Edinburgh Research Explorer Document Version: Publisher's PDF, also known as Version of record Published In: Frontiers in Microbiology Publisher Rights Statement: This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) or licensor are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. General rights Copyright for the publications made accessible via the Edinburgh Research Explorer is retained by the author(s) and / or other copyright owners and it is a condition of accessing these publications that users recognise and abide by the legal requirements associated with these rights. Take down policy The University of Edinburgh has made every reasonable effort to ensure that Edinburgh Research Explorer content complies with UK legislation. -
Microbial Methane Formation in Deep Aquifers of a Coal-Bearing Sedimentary Basin, Germany
ORIGINAL RESEARCH published: 20 March 2015 doi: 10.3389/fmicb.2015.00200 Microbial methane formation in deep aquifers of a coal-bearing sedimentary basin, Germany Friederike Gründger 1†, Núria Jiménez 1, Thomas Thielemann 2, Nontje Straaten 1, Tillmann Lüders 3, Hans-Hermann Richnow 4 and Martin Krüger 1* 1 Resource Geochemistry, Geomicrobiology, Federal Institute for Geosciences and Natural Resources, Hannover, Germany, 2 Federal Institute for Geosciences and Natural Resources, Hannover, Germany, 3 Institute of Groundwater Ecology, Helmholtz Center for Environmental Health, Neuherberg, Germany, 4 Department of Isotope Biogeochemistry, Helmholtz Centre for Environmental Research, Leipzig, Germany Edited by: Mark Alexander Lever, Coal-bearing sediments are major reservoirs of organic matter potentially available Eidgenössische Technische for methanogenic subsurface microbial communities. In this study the specific Hochschule Zürich, Switzerland microbial community inside lignite-bearing sedimentary basin in Germany and its Reviewed by: Hiroyuki Imachi, contribution to methanogenic hydrocarbon degradation processes was investigated. Japan Agency for Marine-Earth The stable isotope signature of methane measured in groundwater and coal-rich Science and Technology, Japan Aude Picard, sediment samples indicated methanogenic activity. Analysis of 16S rRNA gene Harvard University, USA sequences showed the presence of methanogenic Archaea, predominantly belonging *Correspondence: to the orders Methanosarcinales and Methanomicrobiales, capable of