DOCSLIB.ORG

Sulfate-Reducing Bacteria in Anaerobic Bioreactors Are Presented in Table 1

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Sulfate-Reducing Bacteria in Anaerobic Bioreactors Are Presented in Table 1 Sulfate-reducing Bacteria inAnaerobi c Bioreactors Stefanie J.W.H. Oude Elferink Promotoren: dr. ir. G. Lettinga bijzonder hoogleraar ind eanaërobisch e zuiveringstechnologie en hergebruik dr. W.M. deVo s hoogleraar ind e microbiologie Co-promotor: dr. ir. AJ.M. Stams universitair docent bij deleerstoelgroe p microbiologie ^OSJO^-M'3^- Stefanie J.W.H.Oud eElferin k Sulfate-reducing Bacteria inAnaerobi c Bioreactors Proefschrift terverkrijgin g van degraa d van doctor op gezag van derecto r magnificus van deLandbouwuniversitei t Wageningen, dr. C.M. Karssen, inhe t openbaar te verdedigen opvrijda g 22me i 1998 des namiddags tehal f twee ind eAula . r.r, A tri ISBN 90 5485 8451 The research described inthi s thesiswa s financially supported by agran t ofth e Innovative Oriented Program (IOP) Committee on Environmental Biotechnology (IOP-m 90209) established by the Dutch Ministry of Economics, and a grant from Pâques BV. Environmental Technology, P.O. Box 52, 8560AB ,Balk , TheNetherlands . BIBLIOTHEEK LANDBOUWUNIVERSITEIT WAGENTNGEN 1 (J ÜOB^ . ^3"£ Stellingen 1. Inhu n lijst van mogelijke scenario's voor de anaërobe afbraak van propionaat onder sulfaatrijke condities vergeten Uberoi enBhattachary a het scenario dat ind e anaërobe waterzuiveringsreactor van depapierfabrie k teEerbee k lijkt opt etreden , namelijk de afbraak vanpropionaa t door syntrofen en sulfaatreduceerders end e afbraak van acetaat en waterstof door sulfaatreduceerders en methanogenen. Ditproefschrift, hoofdstuk 7 UberoiV, Bhattacharya SK (1995)Interactions among sulfate reducers, acetogens, and methanogens in anaerobicpropionate systems. 2. De stelling van McCartney en Oleszkiewicz dat sulfaatreduceerders inanaërob e reactoren waarschijnlijk alleen competerenme t methanogenen voor het aanwezige waterstof, omdat acetaatafbrekende sulfaatreduceerders nog nooit uit anaëroob slib waren geïsoleerd, was correct bij indiening, maar achterhaald bij publicatie. Oude Elferink SJWH, Maas RN, Stams AJM (1993) Characterization of anewl y isolated "Desulfobacterium" species, enriched with acetate from an Upflow Anaerobic Sludge Bed (UASB) reactor. Bioengineer.l:48. McCartney DM, Oleszkiewicz JA (1993) Competition between methanogens and sulfate reducers: effect of CODisulfate ratio and acclimation. Water Environ. Res. 65:655-664. 3. Identificatie vanMethanospirillum hungateii nkorrelsli b metbehul p van transmissie electronenmicroscopie (TEM)blijf t twijfelachtig, ondanks degoe d gedocumenteerde celkenmerken vanM. hungatei. Fang HHP, Li YY, Chui HK (1995) Performance and sludge characteristics of UASB process treating propionate-rich wastewater. Wat. Res. 29:5-895-898. 4. Het ontdekken van eennieuw ebacteriesoor t isgee nkunst , het isoleren en karakteriseren wel. Amann R, Ludwig W, Schleifer K-H (1994 ) Identification of uncultured bacteria: A challenging task for molecular taxonomists. ASM News 60:360-365. 5. Het aantal sulfaatreduceerders in demon d hoeft, zeker gezien hun fermentatieve eigenschappen, niet gelimiteerd teworde n doorhe t beschikbare sulfaat. Van der Hoeven JS,Va n den Kieboom CWA, Schaeken MJM (1995) Sulfate-reducing bacteria in theperiodonta l pocket. Oral Microbiol. Immunol. 10:280-290. 6. Zelfs de meest gecompliceerde methanogene reactor is slechts een vereenvoudigde versie van depens . Van Soest PJ (1994) Nutritional Ecology of the ruminant. 2nded . Cornell University Press, Ithaca, USA. 7. Met geloof envertrouwe n isniet smis ,zolan g hetmaa rnie tblin dis . 8. Leuk wetenschappelijk onderzoek voldoet aandezelfd e criteria als een leukspel . Hetbeva t evolutie entempo ,he ti s eencombinati e vankund e (ofbehendigheid ) en toeval, succes kanworde n toegeschreven aan eigen briljantie en mislukking aan dommepech . 9. Deobservati e van Prof. Dr.Andrease n dat succesvol schrijverschap is gerelateerd aandepressie , alcoholisme enmanisch e depressiviteit, geeft geen positief beeld vanAIO' sdi eprobleemloo s eenperfec t proefschrift schrijven. N. Andreasen. In: De Volkskrant, 4 Oktober 1997. 10. Natuurreservaat "DeBlauw eKamer " is eenmoo i stukje groeneruimte . 11. Met dehondsdage n ishe t gewoonlijk geen hondeweer. 12. Vele handen maken wellicht werk. 13. Een nadeel van sluipverkeer isda t het,ander s dan denaa m doet vermoeden,vaa k met grote snelheid voorbij raast. 14. Netwerken isne twerken . 15. Een slimme meid houdt niet van voorkeursbeleid. Stellingenbehorend bij het proefschrift: "Sulfate reducingbacteria inanaerobic bioreactors." StefanieJ. W.H. OudeElferink, Wageningen, 22mei 1998. Nature,to be commanded, mustbe obeyed. SirFranci s Bacon Aan mijn ouders CONTENTS Chapter page 1 Introduction. 1 2 Desulforhabdus amnigenusgen .nov . sp.nov. , asulfat e reducer isolated 41 fromanaerobi c granular sludge. 3 Desulfobacca acetoxidans gen.nov . sp.nov. , anove l acetate-degrading 49 sulfate reducer isolated from sulfidogenic granular sludge. 4. Kinetics of acetateoxidatio n by two sulfate reducers isolated from anaerobic 59 granular sludge. 5. Isomerisation ofbutyrat e to isobutyrateb yDesulforhabdus amnigenus. 71 6. Detection and quantification ofDesulforhabdus amnigenus in anaerobic 77 anaerobic granular sludgeb y dotblo t hybridization andPC R amplification. 7. Characterization ofth e sulfate-reducing and syntrophic population in granular 87 sludge from a full-scale anaerobic reactor treating papermill wastewater 8. Identification of sulfate reducers andSyntrophobacter sp. in anaerobic granular 103 granular sludgeb y fatty-acid biomarkers and 16SrRN A probing 9. Summary and concluding remarks 119 Samenvatting 126 Curriculum vitae 133 Dankwoord 135 List ofpublication s 136 CHAPTER 1 Introduction Partly published as: Oude Elferink SJWH, Visser A, Hulshoff Pol LW, Stams AJM (1994) Sulfate reduction in methanogenic bioreactors.FEM S Microbiol. Rev. 15,119-136. Stams AJM, Oude Elferink SJWH (1997) Understanding and advancing wastewater treatment. Curr. Opin.Biotechnol . 8,328-334 . Chapter; 1. INTRODUCTION Since the 1970's the full-scale application of anaerobic wastewater treatment has increased rapidly [108,110,134,254]. This interest in anaerobic wastewater treatment was partly due to the increasing energy prices and for the other part due to the more stringent legislation for the discharge of industrial wastewaters. Contrary to anaerobic wastewater treatment systems, conventional aerobic systems demand high energy inputs for aeration, and large amounts of surplus sludge are produced during the purification process [196]. A break-through in the application of anaerobic wastewater treatment systems came with the development of several new anaerobic reactor types with immobilized biomass, e.g. the Upflow Anaerobic Sludge Bed (UASB) reactor [109-111], the Fluidized Bed reactor [72,88] and the Anaerobic Filter [254,255]. These reactor types have been reviewed by others [71,88,108,196]. The system with the widest application is undoubtedly the UASB reactor [110]. At present more than 400 full-scale UASB reactors are in operation for the treatment of industrial wastewaters [223]. In the UASB reactor an uncoupling of the solids retention time and the hydraulic retention time is achieved by the immobilization of anaerobic bacteria into highly active,well-settleabl e sludge granules [80,109,111], Municipal sewage and industrial wastewaters from e.g. sugar-refineries, beer-breweries, potato- processing factories and slaughterhouses, which contain sulfate concentrations of only about 50-200 mg/1, are treated satisfactorily in UASB reactors. However, problems may arise when wastewaters are treated which contain high concentrations of sulfate or sulfite. Some industrial wastewaters, e.g. wastewaters from edible oil industry, paper mills and patato-starch factories, may contain sulfate concentrations of several grams per liter [172,173,253], as aresul t of theus e of sulfuric acid, aver y concentrated andrelativel y cheap strong acid, or sulfite, ableachin g agent, inproductio n processes. During anaerobic treatment of these wastewaters sulfate reduction will interfere with methanogenesis. Occurrence of sulfate reduction has several disadvantages: 1) sulfate reducers and methanogens compete for substrates resulting in a decrease of methane production [172], 2) sulfide is inhibitory for several types of anaerobic bacteria [74,75,100,197], 3) H2S gas is toxic and malodorous and can cause corrosion problems inboiler s and internal combustion engines [172],an d therefore it has to be removed from the biogas, 4) sulfide-containing effluents of anaerobic reactors can not be discharged at the surface water, because sulfide contributes to the oxygen demanding capacity of the water and because of malodor problems. Therefore, a post-treatment of the anaerobically purified wastewater will become essential. In general occurrence of sulfate reduction in anaerobic bioreactors is undesirable due to the problems associated with the process. However, besides the disadvantages, there are also some advantages of the occurrence of sulfate reduction: 1) sulfate reduction can be used together with Introduction sulfide removal techniques as a biotechnological method for the removal of sulfate [29,78,123,188,207], 2) metal-sulfides have extremely low solubilities, a property which can be used to precipitate toxic heavy metals, such as Co, Ni, Pb and Zn [46,123,135], 3) problems with the anaerobic treatment of sulfite-containing wastewater can be solved by the reduction of sulfite to sulfide [173,140]. The following introduction will first describe how microbiological processes in mesophilic
Load more

Recommended publications
  • Multiple Lateral Transfers of Dissimilatory Sulfite Reductase
    JOURNAL OF BACTERIOLOGY, Oct. 2001, p. 6028–6035 Vol. 183, No. 20 0021-9193/01/$04.00ϩ0 DOI: 10.1128/JB.183.20.6028–6035.2001 Copyright © 2001, American Society for Microbiology. All Rights Reserved. Multiple Lateral Transfers of Dissimilatory Sulfite Reductase Genes between Major Lineages of Sulfate-Reducing Prokaryotes MICHAEL KLEIN,1 MICHAEL FRIEDRICH,2 ANDREW J. ROGER,3 PHILIP HUGENHOLTZ,4 SUSAN FISHBAIN,5 1 4 6 1 HEIKE ABICHT, LINDA L. BLACKALL, DAVID A. STAHL, AND MICHAEL WAGNER * 1 Lehrstuhl fu¨r Mikrobiologie, Technische Universita¨t Mu¨nchen, D-85350 Freising, and Department of Biogeochemistry, Max Planck Downloaded from Institute for Terrestrial Microbiology, D-35043-Marburg,2 Germany; Department of Biochemistry and Molecular Biology, Dalhousie University, Halifax, Nova Scotia B3H 4H7, Canada3; Advanced Wastewater Management Centre, Department of Microbiology and Parasitology, The University of Queensland, Brisbane 4072, Queensland, Australia4; Department of Civil Engineering, Northwestern University, Evanston, Illinois 60208-31095; and Department of Civil and Environmental Engineering, University of Washington, Seattle, Washington 98195-27006 Received 26 February 2001/Accepted 3 July 2001 http://jb.asm.org/ A large fragment of the dissimilatory sulfite reductase genes (dsrAB) was PCR amplified and fully sequenced from 30 reference strains representing all recognized lineages of sulfate-reducing bacteria. In addition, the sequence of the dsrAB gene homologs of the sulfite reducer Desulfitobacterium dehalogenans was determined. In contrast to previous reports, comparative analysis of all available DsrAB sequences produced a tree topology partially inconsistent with the corresponding 16S rRNA phylogeny. For example, the DsrAB sequences of -several Desulfotomaculum species (low G؉C gram-positive division) and two members of the genus Thermode sulfobacterium (a separate bacterial division) were monophyletic with ␦-proteobacterial DsrAB sequences.
    [Show full text]
  • Information to Users
    INFORMATION TO USERS This reproduction was made from a copy of a manuscript sent to us for publication and microfilming. While the most advanced technology has been used to pho­ tograph and reproduce this manuscript, the quality of the reproduction is heavily dependent upon the quédlty of the material submitted. Pages in any manuscript may have indistinct print. In all cases the best available copy has been filmed. The following explanation of techniques is provided to help clarify notations which may appear on this reproduction. 1. Manuscripts may not always be complete. When it is not possible to obtain missing pages, a note appears to indicate this. 2. When copyrighted materials are removed from the manuscript, a note ap­ pears to indicate this. 3. Oversize materials (maps, drawings, and charts) are photographed by sec­ tioning the original, beginning at the upper left hemd comer and continu­ ing from left to right in equal sections with small overlaps. Each oversize page is also filmed as one exposure and is available, for an additional charge, as a standard 35mm slide or in black and white paper format. * 4. Most photographs reproduce acceptably on positive microfilm or micro­ fiche but lack clarity on xerographic copies made from the microfilm. For an additional charge, all photographs are available in black and white stcmdard 35mm slide format.* *For more information about black and white slides or enlarged paper reproductions, please contact the Dissertations Customer Services Department. IVBcrofilnis lateniai^oiial 8612390 Lee, Jong-Kwon STRESS CORROSION CRACKING AND PITTING OF SENSITIZED TYPE 304 STAINLESS STEEL IN CHLORIDE SOLUTIONS CONTAINING SULFUR SPECIES AT TEMPERATURES FROM 50 TO 200 DEGREES C The Ohio State University Ph.D.
    [Show full text]
  • Novel Bacterial Diversity in an Anchialine Blue Hole On
    NOVEL BACTERIAL DIVERSITY IN AN ANCHIALINE BLUE HOLE ON ABACO ISLAND, BAHAMAS A Thesis by BRETT CHRISTOPHER GONZALEZ Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements for the degree of MASTER OF SCIENCE December 2010 Major Subject: Wildlife and Fisheries Sciences NOVEL BACTERIAL DIVERSITY IN AN ANCHIALINE BLUE HOLE ON ABACO ISLAND, BAHAMAS A Thesis by BRETT CHRISTOPHER GONZALEZ Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements for the degree of MASTER OF SCIENCE Approved by: Chair of Committee, Thomas Iliffe Committee Members, Robin Brinkmeyer Daniel Thornton Head of Department, Thomas Lacher, Jr. December 2010 Major Subject: Wildlife and Fisheries Sciences iii ABSTRACT Novel Bacterial Diversity in an Anchialine Blue Hole on Abaco Island, Bahamas. (December 2010) Brett Christopher Gonzalez, B.S., Texas A&M University at Galveston Chair of Advisory Committee: Dr. Thomas Iliffe Anchialine blue holes found in the interior of the Bahama Islands have distinct fresh and salt water layers, with vertical mixing, and dysoxic to anoxic conditions below the halocline. Scientific cave diving exploration and microbiological investigations of Cherokee Road Extension Blue Hole on Abaco Island have provided detailed information about the water chemistry of the vertically stratified water column. Hydrologic parameters measured suggest that circulation of seawater is occurring deep within the platform. Dense microbial assemblages which occurred as mats on the cave walls below the halocline were investigated through construction of 16S rRNA clone libraries, finding representatives across several bacterial lineages including Chlorobium and OP8.
    [Show full text]
  • Geomicrobiological Processes in Extreme Environments: a Review
    202 Articles by Hailiang Dong1, 2 and Bingsong Yu1,3 Geomicrobiological processes in extreme environments: A review 1 Geomicrobiology Laboratory, China University of Geosciences, Beijing, 100083, China. 2 Department of Geology, Miami University, Oxford, OH, 45056, USA. Email: [email protected] 3 School of Earth Sciences, China University of Geosciences, Beijing, 100083, China. The last decade has seen an extraordinary growth of and Mancinelli, 2001). These unique conditions have selected Geomicrobiology. Microorganisms have been studied in unique microorganisms and novel metabolic functions. Readers are directed to recent review papers (Kieft and Phelps, 1997; Pedersen, numerous extreme environments on Earth, ranging from 1997; Krumholz, 2000; Pedersen, 2000; Rothschild and crystalline rocks from the deep subsurface, ancient Mancinelli, 2001; Amend and Teske, 2005; Fredrickson and Balk- sedimentary rocks and hypersaline lakes, to dry deserts will, 2006). A recent study suggests the importance of pressure in the origination of life and biomolecules (Sharma et al., 2002). In and deep-ocean hydrothermal vent systems. In light of this short review and in light of some most recent developments, this recent progress, we review several currently active we focus on two specific aspects: novel metabolic functions and research frontiers: deep continental subsurface micro- energy sources. biology, microbial ecology in saline lakes, microbial Some metabolic functions of continental subsurface formation of dolomite, geomicrobiology in dry deserts, microorganisms fossil DNA and its use in recovery of paleoenviron- Because of the unique geochemical, hydrological, and geological mental conditions, and geomicrobiology of oceans. conditions of the deep subsurface, microorganisms from these envi- Throughout this article we emphasize geomicrobiological ronments are different from surface organisms in their metabolic processes in these extreme environments.
    [Show full text]
  • Supplementary Information for Microbial Electrochemical Systems Outperform Fixed-Bed Biofilters for Cleaning-Up Urban Wastewater
    Electronic Supplementary Material (ESI) for Environmental Science: Water Research & Technology. This journal is © The Royal Society of Chemistry 2016 Supplementary information for Microbial Electrochemical Systems outperform fixed-bed biofilters for cleaning-up urban wastewater AUTHORS: Arantxa Aguirre-Sierraa, Tristano Bacchetti De Gregorisb, Antonio Berná, Juan José Salasc, Carlos Aragónc, Abraham Esteve-Núñezab* Fig.1S Total nitrogen (A), ammonia (B) and nitrate (C) influent and effluent average values of the coke and the gravel biofilters. Error bars represent 95% confidence interval. Fig. 2S Influent and effluent COD (A) and BOD5 (B) average values of the hybrid biofilter and the hybrid polarized biofilter. Error bars represent 95% confidence interval. Fig. 3S Redox potential measured in the coke and the gravel biofilters Fig. 4S Rarefaction curves calculated for each sample based on the OTU computations. Fig. 5S Correspondence analysis biplot of classes’ distribution from pyrosequencing analysis. Fig. 6S. Relative abundance of classes of the category ‘other’ at class level. Table 1S Influent pre-treated wastewater and effluents characteristics. Averages ± SD HRT (d) 4.0 3.4 1.7 0.8 0.5 Influent COD (mg L-1) 246 ± 114 330 ± 107 457 ± 92 318 ± 143 393 ± 101 -1 BOD5 (mg L ) 136 ± 86 235 ± 36 268 ± 81 176 ± 127 213 ± 112 TN (mg L-1) 45.0 ± 17.4 60.6 ± 7.5 57.7 ± 3.9 43.7 ± 16.5 54.8 ± 10.1 -1 NH4-N (mg L ) 32.7 ± 18.7 51.6 ± 6.5 49.0 ± 2.3 36.6 ± 15.9 47.0 ± 8.8 -1 NO3-N (mg L ) 2.3 ± 3.6 1.0 ± 1.6 0.8 ± 0.6 1.5 ± 2.0 0.9 ± 0.6 TP (mg
    [Show full text]
  • Identification and Characterization of Oxalate Oxidoreductase, A
    University of Nebraska - Lincoln DigitalCommons@University of Nebraska - Lincoln Biochemistry -- Faculty Publications Biochemistry, Department of 2010 Identification and Characterization of Oxalate Oxidoreductase, a Novel Thiamine Pyrophosphate-dependent 2-Oxoacid Oxidoreductase That Enables Anaerobic Growth on Oxalate Elizabeth Pierce University of Michigan, Ann Arbor Donald F. Becker University of Nebraska-Lincoln, [email protected] Stephen W. Ragsdale University of Michigan, Ann Arbor, [email protected] Follow this and additional works at: https://digitalcommons.unl.edu/biochemfacpub Part of the Biochemistry Commons, Biotechnology Commons, and the Other Biochemistry, Biophysics, and Structural Biology Commons Pierce, Elizabeth; Becker, Donald F.; and Ragsdale, Stephen W., "Identification and Characterization of Oxalate Oxidoreductase, a Novel Thiamine Pyrophosphate-dependent 2-Oxoacid Oxidoreductase That Enables Anaerobic Growth on Oxalate" (2010). Biochemistry -- Faculty Publications. 179. https://digitalcommons.unl.edu/biochemfacpub/179 This Article is brought to you for free and open access by the Biochemistry, Department of at DigitalCommons@University of Nebraska - Lincoln. It has been accepted for inclusion in Biochemistry -- Faculty Publications by an authorized administrator of DigitalCommons@University of Nebraska - Lincoln. THE JOURNAL OF BIOLOGICAL CHEMISTRY VOL. 285, NO. 52, pp. 40515–40524, December 24, 2010 © 2010 by The American Society for Biochemistry and Molecular Biology, Inc. Printed in the U.S.A. Identification and Characterization of Oxalate Oxidoreductase, a Novel Thiamine Pyrophosphate-dependent 2-Oxoacid Oxidoreductase That Enables Anaerobic Growth on Oxalate*□S Received for publication, June 17, 2010, and in revised form, October 15, 2010 Published, JBC Papers in Press, October 18, 2010, DOI 10.1074/jbc.M110.155739 Elizabeth Pierce‡, Donald F. Becker§, and Stephen W.
    [Show full text]
  • Pila Genes. the Location of Alpha Helices (Represented by Red H) and Beta Strands (Represented by Yellow E) Was Predicted with Jpred 4 (Drozdetskiy Et Al, 2015)
    Supplementary Figure S1. Secondary structure of the N-terminus of PilA proteins from Desulfuromondales species and other bacteria that possess type IVa pilA genes. The location of alpha helices (represented by red H) and beta strands (represented by yellow E) was predicted with Jpred 4 (Drozdetskiy et al, 2015). Transmembrane helices (green background) were predicted with TmPred (Hofmann & Stoffel, 1993), TMHMM (Krogh et al, 2001), and HMMTOP (Tusnady & Simon, 2001). G. bemidjiensis (Gbem_2590) MLNKLRSNKGFTLIELLIVVAIIGILAAIAIPQFSAYREKAYNAASNSDLKNFKTGLEAFNADFQTYPAAYVASTN ---HHH----HHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHH-----HHHHHHHHHH-------EEEE--- G. bremensis (K419DRAFT_00801) MLNKLRSNKGFTLIELLIVVAIIGILAAIAIPQFSAYREKAYNAASNSDLKNWKTGQEAYQADFQAYPAAYDVH --HHHH----HHHHHHHHHHHHHHHHHHH----HHHHHHHHHH------HHHHHHHHHHHHHHH---------- Pelobacter seleniigenes (N909DRAFT_0006) MLKKFRKNEKGFTLIELLIVVAIIGILAAIAIPQFASYRQKAFNSASQSDLKTIKTSLEGYYTDEYYYPY --HHHHH-----HHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHH------- Geobacter sp. OR-1 (WP_041974243) MLSKLRSNKGFTLIELLIVVAIIGILAAIAIPQFSAYREKAYNTAANADDKNAKTGEEAYNADNQKYPLAYDQH --HHHHH----HHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHH------------ Geobacter sp. M18 (GM18_2492) MLNKIRSNKGFTLIELLIVVAIIGILAAIAIPQFSAYRAKAYNAAANSDLKNIKTGMEAYMADRQAYPVSLDER --HHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------------ Geobacter sp. M21 MLNKLRSNKGFTLIELLIVVAIIGILAAIAIPQFSAYRAKAYNSAANSDLKNMKTGMEAYMADRQAYPALLDQR --HHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----------- Desulfuromonas
    [Show full text]
  • Phylogenetic and Functional Characterization of Symbiotic Bacteria in Gutless Marine Worms (Annelida, Oligochaeta)
    Phylogenetic and functional characterization of symbiotic bacteria in gutless marine worms (Annelida, Oligochaeta) Dissertation zur Erlangung des Grades eines Doktors der Naturwissenschaften -Dr. rer. nat.- dem Fachbereich Biologie/Chemie der Universität Bremen vorgelegt von Anna Blazejak Oktober 2005 Die vorliegende Arbeit wurde in der Zeit vom März 2002 bis Oktober 2005 am Max-Planck-Institut für Marine Mikrobiologie in Bremen angefertigt. 1. Gutachter: Prof. Dr. Rudolf Amann 2. Gutachter: Prof. Dr. Ulrich Fischer Tag des Promotionskolloquiums: 22. November 2005 Contents Summary ………………………………………………………………………………….… 1 Zusammenfassung ………………………………………………………………………… 2 Part I: Combined Presentation of Results A Introduction .…………………………………………………………………… 4 1 Definition and characteristics of symbiosis ...……………………………………. 4 2 Chemoautotrophic symbioses ..…………………………………………………… 6 2.1 Habitats of chemoautotrophic symbioses .………………………………… 8 2.2 Diversity of hosts harboring chemoautotrophic bacteria ………………… 10 2.2.1 Phylogenetic diversity of chemoautotrophic symbionts …………… 11 3 Symbiotic associations in gutless oligochaetes ………………………………… 13 3.1 Biogeography and phylogeny of the hosts …..……………………………. 13 3.2 The environment …..…………………………………………………………. 14 3.3 Structure of the symbiosis ………..…………………………………………. 16 3.4 Transmission of the symbionts ………..……………………………………. 18 3.5 Molecular characterization of the symbionts …..………………………….. 19 3.6 Function of the symbionts in gutless oligochaetes ..…..…………………. 20 4 Goals of this thesis …….…………………………………………………………..
    [Show full text]
  • Impacts of Desulfobacterales and Chromatiales on Sulfate Reduction in The
    bioRxiv preprint doi: https://doi.org/10.1101/2020.08.16.252635; this version posted November 6, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 1 Impacts of Desulfobacterales and Chromatiales on sulfate reduction in the 2 subtropical mangrove ecosystem as revealed by SMDB analysis 3 Shuming Mo 1, †, Jinhui Li 1, †, Bin Li 2, Ran Yu 1, Shiqing Nie 1, Zufan Zhang 1, Jianping 4 Liao 3, Qiong Jiang 1, Bing Yan 2, *, and Chengjian Jiang 1, 2 * 5 1 State Key Laboratory for Conservation and Utilization of Subtropical Agro- 6 bioresources, Guangxi Research Center for Microbial and Enzyme Engineering 7 Technology, College of Life Science and Technology, Guangxi University, Nanning 8 530004, China. 9 2 Guangxi Key Lab of Mangrove Conservation and Utilization, Guangxi Mangrove 10 Research Center, Guangxi Academy of Sciences, Beihai 536000, China. 11 3 School of Computer and Information Engineering, Nanning Normal University, 12 Nanning 530299, China. 13 † These authors contributed equally to this work. 14 *: Corresponding Author: 15 Tel: +86-771-3270736; Fax: +86-771-3237873 16 Email: [email protected] (CJ); [email protected] (BY) 17 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.08.16.252635; this version posted November 6, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity.
    [Show full text]
  • Biogeochemical Processes and Microbial Diversity of the Gullfaks and Tommeliten Methane Seeps (Northern North Sea)
    Biogeosciences, 5, 1127–1144, 2008 www.biogeosciences.net/5/1127/2008/ Biogeosciences © Author(s) 2008. This work is distributed under the Creative Commons Attribution 3.0 License. Biogeochemical processes and microbial diversity of the Gullfaks and Tommeliten methane seeps (Northern North Sea) G. Wegener1, M. Shovitri1, K. Knittel1, H. Niemann1,2,*, M. Hovland3, and A. Boetius1,2,4 1Max Planck Institute for Marine Microbiology, Bremen, Germany 2Alfred Wegener Institute for Polar and Marine Research, Bremerhaven, Germany 3Statoil, Stavanger, Norway 4Jacobs University Bremen, Bremen, Germany *now at: Institute for Environmental Geosciences, University of Basel, Switzerland Received: 21 January 2008 – Published in Biogeosciences Discuss.: 25 February 2008 Revised: 3 June 2008 – Accepted: 11 July 2008 – Published: 18 August 2008 Abstract. Fluid flow related seafloor structures and gas seeps microbial community incorporates methane or its metabo- were detected in the North Sea in the 1970s and 1980s by lites. The microbial community composition of both shallow acoustic sub-bottom profiling and oil rig surveys. A vari- seeps shows high similarities to the deep water seeps asso- ety of features like pockmarks, gas vents and authigenic car- ciated with gas hydrates such as Hydrate Ridge or the Eel bonate cements were found to be associated with sites of River basin. oil and gas exploration, indicating a link between these sur- face structures and the underlying, deep hydrocarbon reser- voirs. In this study we performed acoustic surveys and videographic observation at Gullfaks, Holene Trench, Tom- 1 Introduction meliten, Witch’s Hole and the giant pockmarks of the UK Block 15/25, to investigate the occurrence and distribution of The North Sea is a marginal sea of the Atlantic on the Eu- cold seep ecosystems in the Northern North Sea.
    [Show full text]
  • Metatranscriptome Analysis of Microbial Communities in Rice Microcosms
    Metatranscriptome analysis of microbial communities in rice microcosms Dissertation zur Erlangung des akademischen Grades Doktor der Naturwissenschaften (Dr. rer. nat) dem Fachbereich Biologie der Philipps-Universität Marburg/Lahn vorgelegt von Yongkyu Kim aus Seoul, Südkorea Marburg an der Lahn | 2012 Metatranscriptome analysis of microbial communities in rice microcosms Doctoral thesis Submitted in the fulfillment of the requirements for a doctoral degree “Doktorgrad der Naturwissenschaften (Dr. rer.nat.)” to the faculty of biology – Philipps-Universität Marburg by Yongkyu Kim From Seoul, South Korea Marburg/Lahn | 2012 The research for the completion of this work was carried out from October 2008 to April 2012 in the Department of Biogeochemistry at the Max Planck Institute for Terrestrial Microbiology under the supervision of PD. Dr. Werner Liesack. Thesis was accepted to the Dean, Faculty of Biology, Philipps-Universität Marburg on: First reviewer: PD. Dr. Werner Liesack Second reviewer: Prof. Dr. Martin Thanbichler Date of oral examination: Publication The following papers were published by the date of submission of the present thesis: 1) Mettel C¥, Kim Y¥, Shrestha PM & Liesack W (2010) Extraction of mRNA from Soil. Applied and Environmental Microbiology 76: 5995-6000 ¥ These authors contributed equally to this work 2) Kulichevskaya IS, Serkebaeva YM, Kim Y, Rijpstra WIC, Damsté JSS, Liesack W & Dedysh SN (2012) Telmatocola sphagniphila gen. nov., sp. nov., a Novel Dendriform Planctomycete from Northern Wetlands. Frontiers in Microbiology 3: 1-9 Dedicate to my wife and family Table of Contents Summary IV Zusammenfassung V 1. Introduction 1 1.1. Microorganisms exist in complex communities 1 1.2. Functional analysis of microbial community 3 1.3.
    [Show full text]
  • Microbial Processes in Oil Fields: Culprits, Problems, and Opportunities
    Provided for non-commercial research and educational use only. Not for reproduction, distribution or commercial use. This chapter was originally published in the book Advances in Applied Microbiology, Vol 66, published by Elsevier, and the attached copy is provided by Elsevier for the author's benefit and for the benefit of the author's institution, for non-commercial research and educational use including without limitation use in instruction at your institution, sending it to specific colleagues who know you, and providing a copy to your institution’s administrator. All other uses, reproduction and distribution, including without limitation commercial reprints, selling or licensing copies or access, or posting on open internet sites, your personal or institution’s website or repository, are prohibited. For exceptions, permission may be sought for such use through Elsevier's permissions site at: http://www.elsevier.com/locate/permissionusematerial From: Noha Youssef, Mostafa S. Elshahed, and Michael J. McInerney, Microbial Processes in Oil Fields: Culprits, Problems, and Opportunities. In Allen I. Laskin, Sima Sariaslani, and Geoffrey M. Gadd, editors: Advances in Applied Microbiology, Vol 66, Burlington: Academic Press, 2009, pp. 141-251. ISBN: 978-0-12-374788-4 © Copyright 2009 Elsevier Inc. Academic Press. Author's personal copy CHAPTER 6 Microbial Processes in Oil Fields: Culprits, Problems, and Opportunities Noha Youssef, Mostafa S. Elshahed, and Michael J. McInerney1 Contents I. Introduction 142 II. Factors Governing Oil Recovery 144 III. Microbial Ecology of Oil Reservoirs 147 A. Origins of microorganisms recovered from oil reservoirs 147 B. Microorganisms isolated from oil reservoirs 148 C. Culture-independent analysis of microbial communities in oil reservoirs 155 IV.
    [Show full text]