Recombinant Protein (P01)

TANK (Human) Recombinant Protein (P01)

Catalog # : H00010010-P01 規格 : [ 10 ug ] [ 25 ug ] List All

Specification Application Image

Product Human TANK full-length ORF ( AAH03388.1, 1 a.a. - 119 a.a.) Enzyme-linked Immunoabsorbent Assay Description: recombinant protein with GST-tag at N-terminal. Western Blot (Recombinant Sequence: MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQL protein) SLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVI SGIAREKLPKVDIASAESSI Antibody Production

Host: Wheat Germ (in vitro) Protein Array

Theoretical MW 38.83 (kDa):

Preparation in vitro wheat germ expression system Method:

Purification: Glutathione Sepharose 4 Fast Flow

Quality Control 12.5% SDS-PAGE Stained with Coomassie Blue. Testing:

Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing. Instruction:

Note: Best use within three months from the date of receipt of this protein.

MSDS: Download

Datasheet: Download

Applications

Enzyme-linked Immunoabsorbent Assay

Western Blot (Recombinant protein)

Antibody Production

Page 1 of 2 2016/5/22 Protein Array

Gene Information

Entrez GeneID: 10010

GeneBank BC003388 Accession#:

Protein AAH03388.1 Accession#:

Gene Name: TANK

Gene Alias: I-TRAF,TRAF2

Gene TRAF family member-associated NFKB activator Description:

Omim ID: 603893

Gene Ontology: Hyperlink

Gene Summary: The TRAF (tumor necrosis factor receptor-associated factor) family of proteins associate with and transduce signals from members of the tumor necrosis factor receptor superfamily. The protein encoded by this gene is found in the cytoplasm and can bind to TRAF1, TRAF2, or TRAF3, thereby inhibiting TRAF function by sequestering the TRAFs in a latent state in the cytoplasm. For example, the protein encoded by this gene can block TRAF2 binding to LMP1, the Epstein-Barr virus transforming protein, and inhibit LMP1-mediated NF-kappa-B activation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Other TRAF family member-associated NF-KAPPA-B activator,TRAF Designations: interacting protein TANK

Related Disease Arthritis, Rheumatoid Cardiovascular Diseases Diabetes Mellitus, Type 2 Edema Genetic Predisposition to Disease Hematologic Diseases Hepatitis C Hodgkin Disease Lymphoproliferative Disorders Multiple Myeloma Occupational Diseases Osteoporosis, Postmenopausal Waldenstrom Macroglobulinemia Werner syndrome

Page 2 of 2 2016/5/22