DOCSLIB.ORG

Interactions and Functions of the Ubiquitin Specific Protease 7 in Human Cells

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Interactions and Functions of the Ubiquitin Specific Protease 7 in Human Cells Interactions and Functions of the Ubiquitin Specific Protease 7 in Human Cells by Anna-Marie Georges A thesis submitted in conformity with the requirements for the degree of Doctor of Philosophy Molecular Genetics University of Toronto © Copyright by Anna-Marie Georges 2019 i Interactions and Functions of the Ubiquitin Specific Protease 7 in Human Cells Anna-Marie Georges Doctor of Philosophy Molecular Genetics University of Toronto 2019 ABSTRACT The ubiquitin-specific protease 7 (USP7) is a deubiquitylating enzyme that regulates many important cellular processes and is highly studied for its contributions to cancer. Our lab has previously discovered a binding pocket in the USP7 N-terminal TRAF domain that mediates interactions with target proteins. In this thesis I demonstrate how I contributed to the identification of a second binding pocket located in the Ubl2 ubiquitin-like structure of the USP7 C-terminal domain. Furthermore, to gain a more comprehensive understanding of the interactions and functions of USP7, I used a proteomics approach to profile USP7 interactions in cancer cells. This confirmed reported associations of USP7 with USP11, PPM1G phosphatase and TRIP12 and identified novel interactions with FBXO38 and two DEAD/DEAH-box RNA helicases, DDX24 and DHX40. I show that USP11, PPM1G, DDX24, TRIP12 and FBXO38 bind USP7 through its TRAF binding pocket, while DHX40 interacts through the Ubl2 pocket. Motifs in USP11 and DDX24 that are critical for USP7 binding were also identified. Modulation of USP7 expression levels and inhibition of USP7 catalytic activity showed that USP7 consistently stabilizes DDX24, DHX40, TRIP12 and FBXO38 dependent on its catalytic activity, while USP11 and PPM1G levels were not consistently affected. Together these results better define the mechanisms of USP7 interactions and identify FBXO38, DDX24, and DHX40 as new USP7 ii targets. Furthermore, a BioID approach was used to profile the interactions and putative functions of FBXO38, revealing an interaction with KIF20B, a Kinesin-6 protein required for cytokinesis. I show that depletion of either FBXO38 or USP7 result in dramatic decreases in total KIF20B levels and its localization to the midbody, which were manifested in cytokinetic defects. Furthermore, cytokinetic defects associated with USP7 silencing were rescued by restoring FBXO38 or KIF20B. Therefore, I have identified novel roles for USP7 and FBXO38 in the regulation of cytokinesis. iii ACKNOWLEDGEMENTS First and foremost, I would like to express my deepest gratitude to my advisor Dr. Lori Frappier, for giving me the opportunity to work in such an incredible and supportive lab. You have been the most compassionate, patient, encouraging, approachable and supportive supervisor any grad student could ask for. I will always remember our fun conference trips (especially in Croatia and Montenegro!) and our mutual love of dancing at the MoGen retreats and Christmas parties! Through your mentorship, I have become a better writer, critical thinker and project manager, which will no doubt be instrumental in the success of my future scientific career. Thank you to my committee member Drs Anne-Claude Gingras and Sachdev Sidhu for their encouragement and support and for providing me with invaluable insight throughout my graduate career. Thank you for constantly challenging and motivating me to become a better researcher and scientist. I would also like to thank Dr. Vivian Saridakis for her collaboration and guidance for some of the more biochemical aspects of this project. I want to extend a huge thank you to the Frappier lab family, both past and present. A special shout out to my lab bestie and lunch buddy, Kathy Shire. Thank you for all your technical help with experiments (especially cloning!) and patiently listening to all my frustrations and failures, and sharing my excitement during the successes! I will miss our extensive discussions on Doctor Who (and the many other TV shows we shared in common), and I will especially miss your cakes, even the vegan ones. Thank you to Dr. Natasha Malik for being such an amazing mentor for my first few years, and helping with getting my project started. Jaime, Umama, Carlos, Ashley and Sam, I am so grateful to have met you all and I wish you all the best in your future research endeavors. I would like give a special thanks to my MoGen crew, who were a huge support during my entire graduate career and have become my life-long friends. I feel incredibly lucky to have met and bonded so strongly with such an amazing group of people. I love you all and look forward to the many more memories to come as we progress through the next chapter of our lives! A very special thank you to my incredibly supportive parents, who constantly remind me of how proud they are for my pursuit of graduate school and a career in science. Thank you for your unconditional love and support and for shaping me into the incredibly hard working and disciplined person I am today. iv Finally, this thesis is dedicated to my best friend and life partner, Jonathan, who has been my biggest supporter and cheerleader during my entire graduate career and all other aspects of my life. Thank you for your undying love, emotional support, patience and constantly motivating me to grow professionally and to keep my head held high during the many rough patches of grad school. I couldn’t have done this without you! v TABLE OF CONTENTS ABSTRACT ................................................................................................................................... ii ACKNOWLEDGEMENTS ........................................................................................................ iv TABLE OF CONTENTS ............................................................................................................ vi LIST OF FIGURES ..................................................................................................................... ix LIST OF TABLES ........................................................................................................................ x LIST OF ABBREVIATIONS ..................................................................................................... xi CHAPTER 1 Introduction ........................................................................................................... 1 1.1 THE UBIQUITIN SYSTEM .............................................................................................. 2 1.1.1 Ubiquitin and Ubiquitin conjugation ...................................................................... 2 1.1.2 Polyubiquitylation ................................................................................................... 2 1.1.3 Monoubiquitylation ................................................................................................. 4 1.1.4 E3 ligases ................................................................................................................ 5 1.1.5 Deubiquitylating enzymes ...................................................................................... 7 1.2 UBIQUITIN-SPECIFIC PROTEASE 7 ............................................................................. 9 1.2.1 Deubiquitylation by USP7 .................................................................................... 10 1.2.2 USP7 protein interacting domains and mechanisms of USP7 interactions .......... 12 1.2.3 Roles of USP7 in tumor suppressor regulation ..................................................... 14 1.2.3.1 USP7 plays a key role in regulating the p53 pathway ........................... 14 1.2.3.2 Additional roles of USP7 in tumor suppressor and oncoprotein regulation ............................................................................................... 15 1.2.4 Additional Cellular Functions of USP7 ................................................................ 17 1.2.4.1 Roles of USP7 in cell cycle regulation ................................................... 17 1.2.4.2 USP7 in DNA replication, chromatin remodeling and transcription ..... 18 1.2.4.3 Functions of USP7 in DNA repair .......................................................... 19 1.2.5 The development of USP7 inhibitors for anti-cancer therapies ............................ 20 1.3 CYTOKINESIS ................................................................................................................ 21 1.3.1 The role of the kinesin family member 20B in cytokinesis and abscission .......... 23 1.4 THESIS OUTLINE AND RATIONALE ......................................................................... 24 CHAPTER 2 Identification and characterization of USP7 targets in cancer cells .............. 25 2.1 INTRODUCTION ............................................................................................................ 26 2.2 MATERIALS AND METHODS ...................................................................................... 28 vi 2.2.1 Cell Lines .............................................................................................................. 28 2.2.2 Plasmids and siRNA ............................................................................................. 28 2.2.3 Affinity Purification coupled to Mass Spectrometry (AP-MS) ............................ 29 2.2.4 Transfections and USP7 inhibitor treatment ......................................................... 30 2.2.5 Western blotting .................................................................................................... 31 2.2.6
Load more

Recommended publications
  • Identification of the Binding Partners for Hspb2 and Cryab Reveals
    Brigham Young University BYU ScholarsArchive Theses and Dissertations 2013-12-12 Identification of the Binding arP tners for HspB2 and CryAB Reveals Myofibril and Mitochondrial Protein Interactions and Non- Redundant Roles for Small Heat Shock Proteins Kelsey Murphey Langston Brigham Young University - Provo Follow this and additional works at: https://scholarsarchive.byu.edu/etd Part of the Microbiology Commons BYU ScholarsArchive Citation Langston, Kelsey Murphey, "Identification of the Binding Partners for HspB2 and CryAB Reveals Myofibril and Mitochondrial Protein Interactions and Non-Redundant Roles for Small Heat Shock Proteins" (2013). Theses and Dissertations. 3822. https://scholarsarchive.byu.edu/etd/3822 This Thesis is brought to you for free and open access by BYU ScholarsArchive. It has been accepted for inclusion in Theses and Dissertations by an authorized administrator of BYU ScholarsArchive. For more information, please contact [email protected], [email protected]. Identification of the Binding Partners for HspB2 and CryAB Reveals Myofibril and Mitochondrial Protein Interactions and Non-Redundant Roles for Small Heat Shock Proteins Kelsey Langston A thesis submitted to the faculty of Brigham Young University in partial fulfillment of the requirements for the degree of Master of Science Julianne H. Grose, Chair William R. McCleary Brian Poole Department of Microbiology and Molecular Biology Brigham Young University December 2013 Copyright © 2013 Kelsey Langston All Rights Reserved ABSTRACT Identification of the Binding Partners for HspB2 and CryAB Reveals Myofibril and Mitochondrial Protein Interactors and Non-Redundant Roles for Small Heat Shock Proteins Kelsey Langston Department of Microbiology and Molecular Biology, BYU Master of Science Small Heat Shock Proteins (sHSP) are molecular chaperones that play protective roles in cell survival and have been shown to possess chaperone activity.
    [Show full text]
  • Inherited Neuropathies
    407 Inherited Neuropathies Vera Fridman, MD1 M. M. Reilly, MD, FRCP, FRCPI2 1 Department of Neurology, Neuromuscular Diagnostic Center, Address for correspondence Vera Fridman, MD, Neuromuscular Massachusetts General Hospital, Boston, Massachusetts Diagnostic Center, Massachusetts General Hospital, Boston, 2 MRC Centre for Neuromuscular Diseases, UCL Institute of Neurology Massachusetts, 165 Cambridge St. Boston, MA 02114 and The National Hospital for Neurology and Neurosurgery, Queen (e-mail: [email protected]). Square, London, United Kingdom Semin Neurol 2015;35:407–423. Abstract Hereditary neuropathies (HNs) are among the most common inherited neurologic Keywords disorders and are diverse both clinically and genetically. Recent genetic advances have ► hereditary contributed to a rapid expansion of identifiable causes of HN and have broadened the neuropathy phenotypic spectrum associated with many of the causative mutations. The underlying ► Charcot-Marie-Tooth molecular pathways of disease have also been better delineated, leading to the promise disease for potential treatments. This chapter reviews the clinical and biological aspects of the ► hereditary sensory common causes of HN and addresses the challenges of approaching the diagnostic and motor workup of these conditions in a rapidly evolving genetic landscape. neuropathy ► hereditary sensory and autonomic neuropathy Hereditary neuropathies (HN) are among the most common Select forms of HN also involve cranial nerves and respiratory inherited neurologic diseases, with a prevalence of 1 in 2,500 function. Nevertheless, in the majority of patients with HN individuals.1,2 They encompass a clinically heterogeneous set there is no shortening of life expectancy. of disorders and vary greatly in severity, spanning a spectrum Historically, hereditary neuropathies have been classified from mildly symptomatic forms to those resulting in severe based on the primary site of nerve pathology (myelin vs.
    [Show full text]
  • 4-6 Weeks Old Female C57BL/6 Mice Obtained from Jackson Labs Were Used for Cell Isolation
    Methods Mice: 4-6 weeks old female C57BL/6 mice obtained from Jackson labs were used for cell isolation. Female Foxp3-IRES-GFP reporter mice (1), backcrossed to B6/C57 background for 10 generations, were used for the isolation of naïve CD4 and naïve CD8 cells for the RNAseq experiments. The mice were housed in pathogen-free animal facility in the La Jolla Institute for Allergy and Immunology and were used according to protocols approved by the Institutional Animal Care and use Committee. Preparation of cells: Subsets of thymocytes were isolated by cell sorting as previously described (2), after cell surface staining using CD4 (GK1.5), CD8 (53-6.7), CD3ε (145- 2C11), CD24 (M1/69) (all from Biolegend). DP cells: CD4+CD8 int/hi; CD4 SP cells: CD4CD3 hi, CD24 int/lo; CD8 SP cells: CD8 int/hi CD4 CD3 hi, CD24 int/lo (Fig S2). Peripheral subsets were isolated after pooling spleen and lymph nodes. T cells were enriched by negative isolation using Dynabeads (Dynabeads untouched mouse T cells, 11413D, Invitrogen). After surface staining for CD4 (GK1.5), CD8 (53-6.7), CD62L (MEL-14), CD25 (PC61) and CD44 (IM7), naïve CD4+CD62L hiCD25-CD44lo and naïve CD8+CD62L hiCD25-CD44lo were obtained by sorting (BD FACS Aria). Additionally, for the RNAseq experiments, CD4 and CD8 naïve cells were isolated by sorting T cells from the Foxp3- IRES-GFP mice: CD4+CD62LhiCD25–CD44lo GFP(FOXP3)– and CD8+CD62LhiCD25– CD44lo GFP(FOXP3)– (antibodies were from Biolegend). In some cases, naïve CD4 cells were cultured in vitro under Th1 or Th2 polarizing conditions (3, 4).
    [Show full text]
  • Mitochondrial Protein Quality Control Mechanisms
    G C A T T A C G G C A T genes Review Mitochondrial Protein Quality Control Mechanisms Pooja Jadiya * and Dhanendra Tomar * Center for Translational Medicine, Lewis Katz School of Medicine, Temple University, Philadelphia, PA 19140, USA * Correspondence: [email protected] (P.J.); [email protected] (D.T.); Tel.: +1-215-707-9144 (D.T.) Received: 29 April 2020; Accepted: 15 May 2020; Published: 18 May 2020 Abstract: Mitochondria serve as a hub for many cellular processes, including bioenergetics, metabolism, cellular signaling, redox balance, calcium homeostasis, and cell death. The mitochondrial proteome includes over a thousand proteins, encoded by both the mitochondrial and nuclear genomes. The majority (~99%) of proteins are nuclear encoded that are synthesized in the cytosol and subsequently imported into the mitochondria. Within the mitochondria, polypeptides fold and assemble into their native functional form. Mitochondria health and integrity depend on correct protein import, folding, and regulated turnover termed as mitochondrial protein quality control (MPQC). Failure to maintain these processes can cause mitochondrial dysfunction that leads to various pathophysiological outcomes and the commencement of diseases. Here, we summarize the current knowledge about the role of different MPQC regulatory systems such as mitochondrial chaperones, proteases, the ubiquitin-proteasome system, mitochondrial unfolded protein response, mitophagy, and mitochondria-derived vesicles in the maintenance of mitochondrial proteome and health. The proper understanding of mitochondrial protein quality control mechanisms will provide relevant insights to treat multiple human diseases. Keywords: mitochondria; proteome; ubiquitin; proteasome; chaperones; protease; mitophagy; mitochondrial protein quality control; mitochondria-associated degradation; mitochondrial unfolded protein response 1. Introduction Mitochondria are double membrane, dynamic, and semiautonomous organelles which have several critical cellular functions.
    [Show full text]
  • Appendix 2. Significantly Differentially Regulated Genes in Term Compared with Second Trimester Amniotic Fluid Supernatant
    Appendix 2. Significantly Differentially Regulated Genes in Term Compared With Second Trimester Amniotic Fluid Supernatant Fold Change in term vs second trimester Amniotic Affymetrix Duplicate Fluid Probe ID probes Symbol Entrez Gene Name 1019.9 217059_at D MUC7 mucin 7, secreted 424.5 211735_x_at D SFTPC surfactant protein C 416.2 206835_at STATH statherin 363.4 214387_x_at D SFTPC surfactant protein C 295.5 205982_x_at D SFTPC surfactant protein C 288.7 1553454_at RPTN repetin solute carrier family 34 (sodium 251.3 204124_at SLC34A2 phosphate), member 2 238.9 206786_at HTN3 histatin 3 161.5 220191_at GKN1 gastrokine 1 152.7 223678_s_at D SFTPA2 surfactant protein A2 130.9 207430_s_at D MSMB microseminoprotein, beta- 99.0 214199_at SFTPD surfactant protein D major histocompatibility complex, class II, 96.5 210982_s_at D HLA-DRA DR alpha 96.5 221133_s_at D CLDN18 claudin 18 94.4 238222_at GKN2 gastrokine 2 93.7 1557961_s_at D LOC100127983 uncharacterized LOC100127983 93.1 229584_at LRRK2 leucine-rich repeat kinase 2 HOXD cluster antisense RNA 1 (non- 88.6 242042_s_at D HOXD-AS1 protein coding) 86.0 205569_at LAMP3 lysosomal-associated membrane protein 3 85.4 232698_at BPIFB2 BPI fold containing family B, member 2 84.4 205979_at SCGB2A1 secretoglobin, family 2A, member 1 84.3 230469_at RTKN2 rhotekin 2 82.2 204130_at HSD11B2 hydroxysteroid (11-beta) dehydrogenase 2 81.9 222242_s_at KLK5 kallikrein-related peptidase 5 77.0 237281_at AKAP14 A kinase (PRKA) anchor protein 14 76.7 1553602_at MUCL1 mucin-like 1 76.3 216359_at D MUC7 mucin 7,
    [Show full text]
  • Download (PDF)
    Table S1. Putative miR-322 target transcripts which is highly expressed in MGCs ________________________________________________________________________________ 0610037L13Rik, 1700037H04Rik, 2310061I04Rik, 2810006K23Rik, Abcc5, Abhd16a, Acbd3, Acox1, Acsbg1, Acsl4, Actr1a, Actr2, Adck5, Adh5, Adrbk1, Aff4, Agk, Ahcyl1, Akap11, Akap7, Akirin1, Alg3, Amfr, Ammecr1, Amotl2, Ankfy1, Ankhd1, Ankrd52, Ap2a1, Ap2b1, Ap3b1, Ap3d1, App, Arcn1, Arf3, Arfgap2, Arhgap12, Arhgap5, Arhgdia, Arhgef11, Arih1, Arl2, Arl3, Arl8b, Armcx6, Asap1, Asnsd1, Atf6, Atg13, Atg4b, Atp13a3, Atp5g1, Atp6v1a, Atxn2, Atxn7l3, Atxn7l3b, AW549877, B4galt1, B4galt7, Bace1, Bag5, Baiap2, Baz2a, BC037034, Bcl2l1, Bcl2l2, Bfar, Bmpr1a, Bptf, Brd2, Brd4, Brpf3, Btbd3, Btg2, Cab39, Cacna2d1, Calm1, Capns1, Caprin1, Capza2, Carm1, Caskin1, Cbfa2t3, Cbx5, Cbx6, Cc2d1b, Ccdc127, Ccdc6, Ccnd2, Ccnt2, Ccnyl1, Cd164, Cd2ap, Cdc25a, Cdc27, Cdc37l1, Cdc42se2, Cdca4, Cdipt, Cdk5rap3, Cdk8, Cdk9, Cdv3, Celf1, Cfl2, Chchd3, Chd6, Chmp1a, Chmp7, Chordc1, Chpf, Chpt1, Chst8, Chtf8, Cisd2, Clasrp, Clcn3, Clstn1, Cmpk1, Cnih2, Cnot1, Cnot2, Col4a3bp, Cope, Cops2, Cops7a, Cops7b, Copz1, Coq6, Cpd, Crebzf, Crim1, Crk, Crkl, Csde1, Cse1l, Ctnnb1, Cul4a, Cul4b, Cxx1a, Cxx1b, Cxx1c, D15Ertd621e, D2hgdh, Dcaf7, Dcbld2, Dcp1a, Dctn5, Ddost, Ddr1, Ddx39, Ddx3x, Ddx6, Dedd, Dhdds, Dhx16, Diap1, Dido1, Dlst, Dmtf1, Dnaja2, Dnajb14, Dnajb2, Dnajc1, Dnajc16, Dnajc25, Dph3, Dpm1, Dpp9, Dpy19l4, Dsel, Dtl, Dvl1, Dync1li2, Dynll2, Dynlt3, Dyrk1a, Dyrk1b, Ebna1bp2, Edc4, Eftud2, Egln2, Eif1a, Eif2b2, Eif2s1,
    [Show full text]
  • Identification of Transcriptional Mechanisms Downstream of Nf1 Gene Defeciency in Malignant Peripheral Nerve Sheath Tumors Daochun Sun Wayne State University
    Wayne State University DigitalCommons@WayneState Wayne State University Dissertations 1-1-2012 Identification of transcriptional mechanisms downstream of nf1 gene defeciency in malignant peripheral nerve sheath tumors Daochun Sun Wayne State University, Follow this and additional works at: http://digitalcommons.wayne.edu/oa_dissertations Recommended Citation Sun, Daochun, "Identification of transcriptional mechanisms downstream of nf1 gene defeciency in malignant peripheral nerve sheath tumors" (2012). Wayne State University Dissertations. Paper 558. This Open Access Dissertation is brought to you for free and open access by DigitalCommons@WayneState. It has been accepted for inclusion in Wayne State University Dissertations by an authorized administrator of DigitalCommons@WayneState. IDENTIFICATION OF TRANSCRIPTIONAL MECHANISMS DOWNSTREAM OF NF1 GENE DEFECIENCY IN MALIGNANT PERIPHERAL NERVE SHEATH TUMORS by DAOCHUN SUN DISSERTATION Submitted to the Graduate School of Wayne State University, Detroit, Michigan in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY 2012 MAJOR: MOLECULAR BIOLOGY AND GENETICS Approved by: _______________________________________ Advisor Date _______________________________________ _______________________________________ _______________________________________ © COPYRIGHT BY DAOCHUN SUN 2012 All Rights Reserved DEDICATION This work is dedicated to my parents and my wife Ze Zheng for their continuous support and understanding during the years of my education. I could not achieve my goal without them. ii ACKNOWLEDGMENTS I would like to express tremendous appreciation to my mentor, Dr. Michael Tainsky. His guidance and encouragement throughout this project made this dissertation come true. I would also like to thank my committee members, Dr. Raymond Mattingly and Dr. John Reiners Jr. for their sustained attention to this project during the monthly NF1 group meetings and committee meetings, Dr.
    [Show full text]
  • The Proteasomal Deubiquitinating Enzyme PSMD14 Regulates Macroautophagy by Controlling Golgi-To-ER Retrograde Transport
    Supplementary Materials The proteasomal deubiquitinating enzyme PSMD14 regulates macroautophagy by controlling Golgi-to-ER retrograde transport Bustamante HA., et al. Figure S1. siRNA sequences directed against human PSMD14 used for Validation Stage. Figure S2. Primer pairs sequences used for RT-qPCR. Figure S3. The PSMD14 DUB inhibitor CZM increases the Golgi apparatus area. Immunofluorescence microscopy analysis of the Golgi area in parental H4 cells treated for 4 h either with the vehicle (DMSO; Control) or CZM. The Golgi marker GM130 was used to determine the region of interest in each condition. Statistical significance was determined by Student's t-test. Bars represent the mean ± SEM (n =43 cells). ***P <0.001. Figure S4. CZM causes the accumulation of KDELR1-GFP at the Golgi apparatus. HeLa cells expressing KDELR1-GFP were either left untreated or treated with CZM for 30, 60 or 90 min. Cells were fixed and representative confocal images were acquired. Figure S5. Effect of CZM on proteasome activity. Parental H4 cells were treated either with the vehicle (DMSO; Control), CZM or MG132, for 90 min. Protein extracts were used to measure in vitro the Chymotrypsin-like peptidase activity of the proteasome. The enzymatic activity was quantified according to the cleavage of the fluorogenic substrate Suc-LLVY-AMC to AMC, and normalized to that of control cells. The statistical significance was determined by One-Way ANOVA, followed by Tukey’s test. Bars represent the mean ± SD of biological replicates (n=3). **P <0.01; n.s., not significant. Figure S6. Effect of CZM and MG132 on basal macroautophagy. (A) Immunofluorescence microscopy analysis of the subcellular localization of LC3 in parental H4 cells treated with either with the vehicle (DMSO; Control), CZM for 4 h or MG132 for 6 h.
    [Show full text]
  • Genomic Diagnostics Within a Medically Underserved Population: Efficacy and Implications
    © American College of Medical Genetics and Genomics ORIGINAL RESEARCH ARTICLE Genomic diagnostics within a medically underserved population: efficacy and implications Kevin A. Strauss, MD1, Claudia Gonzaga-Jauregui, PhD2, Karlla W. Brigatti, MS1, Katie B. Williams, MD, PhD1, Alejandra K. King, PhD2, Cristopher Van Hout, PhD2, Donna L. Robinson, CRNP1, Millie Young, RNC1, Kavita Praveen, PhD2, Adam D. Heaps, MS1, Mindy Kuebler, MS1, Aris Baras, MD2, Jeffrey G. Reid, PhD2, John D. Overton, PhD2, Frederick E. Dewey, MD2, Robert N. Jinks, PhD3, Ian Finnegan, BA3, Scott J. Mellis, MD, PhD2, Alan R. Shuldiner, MD2 and Erik G. Puffenberger, PhD1 Purpose: We integrated whole-exome sequencing (WES) and Compared to trio analysis, “family” WES (average seven exomes chromosomal microarray analysis (CMA) into a clinical workflow per proband) reduced filtered candidate variants from 22 ± 6to to serve an endogamous, uninsured, agrarian community. 5 ± 3 per proband. Nineteen (51%) alleles were de novo and 17 Methods: Seventy-nine probands (newborn to 49.8 years) who (46%) inherited; the latter added to a population-based diagnostic presented between 1998 and 2015 remained undiagnosed after panel. We found actionable secondary variants in 21 (4.2%) of 502 biochemical and molecular investigations. We generated WES data subjects, all of whom opted to be informed. for probands and family members and vetted variants through Conclusion: CMA and family-based WES streamline and rephenotyping, segregation analyses, and population studies. economize diagnosis of rare genetic disorders, accelerate novel Results: The most common presentation was neurological disease gene discovery, and create new opportunities for community-based (64%). Seven (9%) probands were diagnosed by CMA.
    [Show full text]
  • Comparative Analysis of the Ubiquitin-Proteasome System in Homo Sapiens and Saccharomyces Cerevisiae
    Comparative Analysis of the Ubiquitin-proteasome system in Homo sapiens and Saccharomyces cerevisiae Inaugural-Dissertation zur Erlangung des Doktorgrades der Mathematisch-Naturwissenschaftlichen Fakultät der Universität zu Köln vorgelegt von Hartmut Scheel aus Rheinbach Köln, 2005 Berichterstatter: Prof. Dr. R. Jürgen Dohmen Prof. Dr. Thomas Langer Dr. Kay Hofmann Tag der mündlichen Prüfung: 18.07.2005 Zusammenfassung I Zusammenfassung Das Ubiquitin-Proteasom System (UPS) stellt den wichtigsten Abbauweg für intrazelluläre Proteine in eukaryotischen Zellen dar. Das abzubauende Protein wird zunächst über eine Enzym-Kaskade mit einer kovalent gebundenen Ubiquitinkette markiert. Anschließend wird das konjugierte Substrat vom Proteasom erkannt und proteolytisch gespalten. Ubiquitin besitzt eine Reihe von Homologen, die ebenfalls posttranslational an Proteine gekoppelt werden können, wie z.B. SUMO und NEDD8. Die hierbei verwendeten Aktivierungs- und Konjugations-Kaskaden sind vollständig analog zu der des Ubiquitin- Systems. Es ist charakteristisch für das UPS, daß sich die Vielzahl der daran beteiligten Proteine aus nur wenigen Proteinfamilien rekrutiert, die durch gemeinsame, funktionale Homologiedomänen gekennzeichnet sind. Einige dieser funktionalen Domänen sind auch in den Modifikations-Systemen der Ubiquitin-Homologen zu finden, jedoch verfügen diese Systeme zusätzlich über spezifische Domänentypen. Homologiedomänen lassen sich als mathematische Modelle in Form von Domänen- deskriptoren (Profile) beschreiben. Diese Deskriptoren können wiederum dazu verwendet werden, mit Hilfe geeigneter Verfahren eine gegebene Proteinsequenz auf das Vorliegen von entsprechenden Homologiedomänen zu untersuchen. Da die im UPS involvierten Homologie- domänen fast ausschließlich auf dieses System und seine Analoga beschränkt sind, können domänen-spezifische Profile zur Katalogisierung der UPS-relevanten Proteine einer Spezies verwendet werden. Auf dieser Basis können dann die entsprechenden UPS-Repertoires verschiedener Spezies miteinander verglichen werden.
    [Show full text]
  • SUPPLEMENTARY MATERIAL Dictyostelium As Model for Studying
    www.intjdevbiol.com SUPPLEMENTARY MATERIAL corresponding to: Dictyostelium as model for studying ubiquitination and deubiquitination BARBARA PERGOLIZZI1, SALVATORE BOZZARO1 and ENRICO BRACCO2 1Department of Clinical and Biological Sciences and 2Department of Oncology, University of Torino, AOU S. Luigi, Orbassano (TO), Italy Full Text for this paper is available at: https://doi.org/10.1387/ijdb.190260eb TABLE S1: Dictyostelium discoideum Ubiquitin and Ubiquitin like family members UBLs/Ub members ID SUMO DDB_G0286189 NEDD8 DDB_G0278711 ATG12 DDB_G0282929 ATG8a DDB_G0286191 UBLs ATG8b DDB_G0290491 UFM DDB_G0295709 URM DDB_G0283737 FAU DDB_G0273743 Ubl5 DDB_G0284205 UbqA DDB_G0282295 UbqD DDB_G0286907 UbqF DDB_G0289449 UbqG DDB_G0282369 UbqH DDB_G0279721 UbqI DDB_G0291928 Ubiquitin UbqJ DDB_G0269458 UbqK DDB_G0280585 UbqN DDB_G0292984 UbqO DDB_G0292908 UbqB DDB_G0280755 UbqC DDB_G0276765 TABLE S2: Dictyostelium discoideum E1 ubiqutin conjugation members E1 Ub/Ubl Activating enzyme ID DDB_G0293306 Ubq DDB_G0268496 DDB_G0279641 SUMO DDB_G0286919 DDB_G0283891 NEDD8 DDB_G0287965 ATG8 DDB_G0271096 ATG12 DDB_G0271096 URM DDB_G0267980 FAT10 DDB_G0277047 ISG15 DDB_G0270272 UFM DDB_G0293306 FAU N.A. Ubl5 N.A. TABLE S3: Dictyostelium discoideum members of DUB family DUBs members D.d. gene ID H.s. gene orthologs name DDB_G0268872 N.A. USP49, USP44 DDB_G0284381 N.A. USP11, USP4, USP15 DDB_G0291239 ubpA USP5, USP13 DDB_G0276443 N.A. USP7 DDB_G0275021 ubpB USP10 DDB_G0290453 usp12 USP12 DDB_G0271264 N.A. USP14 DDB_G0293770 N.A. USP11, USP4, USP15 DDB_G0274207 N.A. USP45, USP16 DDB_G0271798 N.A. USP51 DDB_G0275415 N.A. N.A. USP DDB_G0271348 N.A. USP38 similar to H. sapiens DDB_G0270416 N.A. USP37 and USP26 DDB_G0278929 N.A. USP39 DDB_G0289611 N.A. USP40 DDB_G0274827 N.A. USP42, USP36 DDB_G0274795 N.A. USP48 Cys- DDB_G0292290 N.A. SENP1 dependent DDB_G0278795 senp8 SENP8 proteases DDB_G0293508 N.A.
    [Show full text]
  • Anti-UBL5 (Aa 1-73) Polyclonal Antibody (DPAB- DC2677) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use
    Anti-UBL5 (aa 1-73) polyclonal antibody (DPAB- DC2677) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description This gene encodes a member of a group of proteins similar to ubiquitin. The encoded protein is not thought to degrade proteins like ubiquitin but to affect their function through being bound to target proteins by an isopeptide bond. The gene product has been studied as a link to predisposition to obesity based on its expression in Psammomys obesus, the fat sand rat, which is an animal model for obesity studies. Variation in this gene was found to be significantly associated with some metabolic traits (PMID: 15331561) but not associated with childhood obesity (PMID: 19189687). Pseudogenes of this gene are located on chromosomes 3, 5 and 17. Multiple alternatively spliced variants, encoding the same protein, have been identified. Immunogen UBL5 (NP_077268, 1 a.a. ~ 73 a.a) partial recombinant protein with GST tag. The sequence is MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDG MNLELYYQ Source/Host Mouse Species Reactivity Human Conjugate Unconjugated Applications WB (Recombinant protein), ELISA, Size 50 μl Buffer 50 % glycerol Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION Gene Name UBL5 ubiquitin-like 5 [ Homo sapiens (human) ] Official Symbol UBL5 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved Synonyms UBL5; ubiquitin-like 5; HUB1; ubiquitin-like protein 5; beacon; Entrez Gene ID 59286 Protein Refseq NP_001041706 UniProt ID A0A024R7B0 Chromosome Location 19p13.3 Function molecular_function; protein binding; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.
    [Show full text]