Linguistic Archaeology of South Asia
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
BSW 043 Block 1 English.Pmd
BSW-043 TRIBALS OF SOUTH Indira Gandhi AND CENTRAL INDIA National Open University School of Social Work Block 1 TRIBES OF SOUTH INDIA UNIT 1 Tribes of Andhra Pradesh and Telangana 5 UNIT 2 Tribes of Karnataka 17 UNIT 3 Tribes of Kerala 27 UNIT 4 Tribes of Tamil Nadu 38 UNIT 5 Tribes of Lakshadweep and Puducherry 45 EXPERT COMMITTEE Prof. Virginius Xaxa Dr. Archana Kaushik Dr. Saumya Director – Tata Institute of Associate Professor Faculty Social Sciences Department of Social Work School of Social Work Uzanbazar, Guwahati Delhi University IGNOU, New Delhi Prof. Hilarius Beck Dr. Ranjit Tigga Dr. G. Mahesh Centre for Community Department of Tribal Studies Faculty Organization and Development Indian Social Institute School of Social Work Practice Lodhi Road, New Delhi IGNOU, New Delhi School of Social Work Prof. Gracious Thomas Dr. Sayantani Guin Deonar, Mumbai Faculty Faculty Prof. Tiplut Nongbri School of Social Work School of Social Work Centre for the Study of Social IGNOU, New Delhi IGNOU, New Delhi Systems Dr. Rose Nembiakkim Dr. Ramya Jawaharlal Nehru University Director Faculty New Delhi School of Social Work School of Social Work IGNOU, New Delhi IGNOU, New Delhi COURSE PREPARATION TEAM Block Preparation Team Programme Coordinator Unit 1 Anindita Majumdar Dr. Rose Nembiakkim and Dr. Aneesh Director Unit 2 & 3 Rubina Nusrat School of Social Work Unit 4 Mercy Vungthianmuang IGNOU Unit 5 Dr. Grace Donnemching PRINT PRODUCTION Mr. Kulwant Singh Assistant Registrar (P) SOSW, IGNOU August, 2018 © Indira Gandhi National Open University, 2018 ISBN-978-93-87237-69-8 All rights reserved. No part of this work may be reproduced in any form, by mimeograph or any other means, without permission in writing from the Indira Gandhi National Open University. -
Grammatical Gender in Hindukush Languages
Grammatical gender in Hindukush languages An areal-typological study Julia Lautin Department of Linguistics Independent Project for the Degree of Bachelor 15 HEC General linguistics Bachelor's programme in Linguistics Spring term 2016 Supervisor: Henrik Liljegren Examinator: Bernhard Wälchli Expert reviewer: Emil Perder Project affiliation: “Language contact and relatedness in the Hindukush Region,” a research project supported by the Swedish Research Council (421-2014-631) Grammatical gender in Hindukush languages An areal-typological study Julia Lautin Abstract In the mountainous area of the Greater Hindukush in northern Pakistan, north-western Afghanistan and Kashmir, some fifty languages from six different genera are spoken. The languages are at the same time innovative and archaic, and are of great interest for areal-typological research. This study investigates grammatical gender in a 12-language sample in the area from an areal-typological perspective. The results show some intriguing features, including unexpected loss of gender, languages that have developed a gender system based on the semantic category of animacy, and languages where this animacy distinction is present parallel to the inherited gender system based on a masculine/feminine distinction found in many Indo-Aryan languages. Keywords Grammatical gender, areal-typology, Hindukush, animacy, nominal categories Grammatiskt genus i Hindukush-språk En areal-typologisk studie Julia Lautin Sammanfattning I den här studien undersöks grammatiskt genus i ett antal språk som talas i ett bergsområde beläget i norra Pakistan, nordvästra Afghanistan och Kashmir. I området, här kallat Greater Hindukush, talas omkring 50 olika språk från sex olika språkfamiljer. Det stora antalet språk tillsammans med den otillgängliga terrängen har gjort att språken är arkaiska i vissa hänseenden och innovativa i andra, vilket gör det till ett intressant område för arealtypologisk forskning. -
Introduction
INTRODUCTION Hindi, an Indo-European language, is the official language of India, spoken by about 40% of the more than one billion citizens of India. It is also the official language in certain of the territories where a sizeable diaspora settled such as the Republic of Mauritius1. But the label ‘Hindi’ covers considerably distinct speeches, as evidenced by the number of regional varieties covered by the category Hindi in the various Censuses of India: 91 mother tongues in the 1961 Census, up to 331 languages or speeches according to Srivastava 1994, totalizing to six hundred millions speakers (Bhatia 1987: 9). On the other end, the notion that Standard Hindi, more or less corresponding to the variety used in written literature and media, does not exist as a mother tongue, has gained currency during the seventies and eighties: according to Gumperz & Naim (1960), modern standard Hindi is a second or third speech for most of its speakers, being a native language for a small section of the urban population, which until recently was itself a small minority of the global Indian population. However, due to the rapid increase in this urban population, Hindi native speakers can no longer be considered as a non-significant minority, as noticed by Ohala (1983) and Singh & Agnihotri (1997). Many scholars still consider that the modern colloquial language, used for instance in popular movies, does not differ from modern colloquial Urdu. Similarly, many consider that the higher registers of both languages are still only two styles of one and the same language. According to Abdul Haq (1961), “the language we speak and write and call by the name Urdu today is derived from Hindi and constituted of Hindi”. -
Global Journal of Human Social Science
Online ISSN: 2249-460X Print ISSN: 0975-587X exploration Volume 11 Issue 5 of version 1.0 innovations4 Comparative Analysis Patterns of Contemporary Geographic Information Facet of Human Rights October 2011 Global Journal of Human Social Science Global Journal of Human Social Science Volume 11 Issue 5 (Ver. 1.0) Open Association of Research Society *OREDO-RXUQDORI+XPDQ *OREDO-RXUQDOV,QF 6RFLDO6FLHQFHV $'HODZDUH86$,QFRUSRUDWLRQZLWK³*RRG6WDQGLQJ´Reg. Number: 0423089 6SRQVRUV Open Association of Research Society $OOULJKWVUHVHUYHG 2SHQ6FLHQWLILF6WDQGDUGV 7KLVLVDVSHFLDOLVVXHSXEOLVKHGLQYHUVLRQ RI³*OREDO-RXUQDORI+XPDQ6RFLDO 3XEOLVKHU¶V+HDGTXDUWHUVRIILFH 6FLHQFHV´%\*OREDO-RXUQDOV,QF $OODUWLFOHVDUHRSHQDFFHVVDUWLFOHVGLVWULEXWHG *OREDO-RXUQDOV,QF+HDGTXDUWHUV&RUSRUDWH2IILFH XQGHU³*OREDO-RXUQDORI+XPDQ6RFLDO 6FLHQFHV´ &DPEULGJH2IILFH&HQWHU,,&DQDO3DUN)ORRU1R 5HDGLQJ/LFHQVHZKLFKSHUPLWVUHVWULFWHGXVH WKCambridge (Massachusetts)3LQ0$ (QWLUHFRQWHQWVDUHFRS\ULJKWE\RI³*OREDO -RXUQDORI+XPDQ6RFLDO6FLHQFHV´XQOHVV 8QLWHG6WDWHV RWKHUZLVHQRWHGRQVSHFLILFDUWLFOHV 86$7ROO)UHH 86$7ROO)UHH)D[ 1RSDUWRIWKLVSXEOLFDWLRQPD\EHUHSURGXFHG RUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQV 2IIVHW7\SHVHWWLQJ HOHFWURQLFRUPHFKDQLFDOLQFOXGLQJ SKRWRFRS\UHFRUGLQJRUDQ\LQIRUPDWLRQ VWRUDJHDQGUHWULHYDOV\VWHPZLWKRXWZULWWHQ Open Association of Research Society , Marsh Road, SHUPLVVLRQ Rainham, Essex, London RM13 8EU 7KHRSLQLRQVDQGVWDWHPHQWVPDGHLQWKLV United Kingdom. ERRNDUHWKRVHRIWKHDXWKRUVFRQFHUQHG 8OWUDFXOWXUHKDVQRWYHULILHGDQGQHLWKHU FRQILUPVQRUGHQLHVDQ\RIWKHIRUHJRLQJDQG QRZDUUDQW\RUILWQHVVLVLPSOLHG -
Tamil Teaching and Learning Process
Vol.1 No.3 July, 2013 ISSN : 2320 –2653 Tamil Teaching and Learning Process R.Nithya Research Scholar, Govt. Arts & Science College, Ooty, India Dr. Senavarayar Professor, Govt. Arts & Science College, Ooty, India Abstract ‘Tamil’ is one of the classical languages of India and the other one is Sanskrit Language. Tamil is one of the major languages of the Dravidian family of languages. Most of the persons who speak Tamil Language reside in the Indian state of Tamil Nadu, Tamil is also spoken in many parts of the world. Large concentration of Tamil speaking people is located in Sri Lanka, Malaysia, and Singapore, as also in other South Indian states of Andhra Pradesh, Karnataka, and Kerala and major cities of India. In fact, Tamil speaking people are found in all the time zones of the world. There are more than 74 million people who speak Tamil as their native language. Tamil is one of the few living classical languages and has an unbroken literary tradition of over two millennia. The written language has changed little during this period, with the result that classical literature is as much a part of everyday Tamil as modern literature. Tamil school-children, for example, are still taught the alphabet using the átticúdi, an alphabet rhyme written around the first century A.D. Teaching and learning are related terms. In teaching - learning process, the teacher, the learner, the curriculum and other variables are organized in a systematic way to attain some pre-determined goal. A language to be studied must be the mother tongue or the regional language. -
Languages of Kohistan. Sociolinguistic Survey of Northern
SOCIOLINGUISTIC SURVEY OF NORTHERN PAKISTAN VOLUME 1 LANGUAGES OF KOHISTAN Sociolinguistic Survey of Northern Pakistan Volume 1 Languages of Kohistan Volume 2 Languages of Northern Areas Volume 3 Hindko and Gujari Volume 4 Pashto, Waneci, Ormuri Volume 5 Languages of Chitral Series Editor Clare F. O’Leary, Ph.D. Sociolinguistic Survey of Northern Pakistan Volume 1 Languages of Kohistan Calvin R. Rensch Sandra J. Decker Daniel G. Hallberg National Institute of Summer Institute Pakistani Studies of Quaid-i-Azam University Linguistics Copyright © 1992 NIPS and SIL Published by National Institute of Pakistan Studies, Quaid-i-Azam University, Islamabad, Pakistan and Summer Institute of Linguistics, West Eurasia Office Horsleys Green, High Wycombe, BUCKS HP14 3XL United Kingdom First published 1992 Reprinted 2002 ISBN 969-8023-11-9 Price, this volume: Rs.300/- Price, 5-volume set: Rs.1500/- To obtain copies of these volumes within Pakistan, contact: National Institute of Pakistan Studies Quaid-i-Azam University, Islamabad, Pakistan Phone: 92-51-2230791 Fax: 92-51-2230960 To obtain copies of these volumes outside of Pakistan, contact: International Academic Bookstore 7500 West Camp Wisdom Road Dallas, TX 75236, USA Phone: 1-972-708-7404 Fax: 1-972-708-7433 Internet: http://www.sil.org Email: [email protected] REFORMATTING FOR REPRINT BY R. CANDLIN. CONTENTS Preface............................................................................................................viii Maps................................................................................................................. -
Indian Hieroglyphs
Indian hieroglyphs Indus script corpora, archaeo-metallurgy and Meluhha (Mleccha) Jules Bloch’s work on formation of the Marathi language (Bloch, Jules. 2008, Formation of the Marathi Language. (Reprint, Translation from French), New Delhi, Motilal Banarsidass. ISBN: 978-8120823228) has to be expanded further to provide for a study of evolution and formation of Indian languages in the Indian language union (sprachbund). The paper analyses the stages in the evolution of early writing systems which began with the evolution of counting in the ancient Near East. Providing an example from the Indian Hieroglyphs used in Indus Script as a writing system, a stage anterior to the stage of syllabic representation of sounds of a language, is identified. Unique geometric shapes required for tokens to categorize objects became too large to handle to abstract hundreds of categories of goods and metallurgical processes during the production of bronze-age goods. In such a situation, it became necessary to use glyphs which could distinctly identify, orthographically, specific descriptions of or cataloging of ores, alloys, and metallurgical processes. About 3500 BCE, Indus script as a writing system was developed to use hieroglyphs to represent the ‘spoken words’ identifying each of the goods and processes. A rebus method of representing similar sounding words of the lingua franca of the artisans was used in Indus script. This method is recognized and consistently applied for the lingua franca of the Indian sprachbund. That the ancient languages of India, constituted a sprachbund (or language union) is now recognized by many linguists. The sprachbund area is proximate to the area where most of the Indus script inscriptions were discovered, as documented in the corpora. -
Language Documentation and Description
Language Documentation and Description ISSN 1740-6234 ___________________________________________ This article appears in: Language Documentation and Description, vol 17. Editor: Peter K. Austin Countering the challenges of globalization faced by endangered languages of North Pakistan ZUBAIR TORWALI Cite this article: Torwali, Zubair. 2020. Countering the challenges of globalization faced by endangered languages of North Pakistan. In Peter K. Austin (ed.) Language Documentation and Description 17, 44- 65. London: EL Publishing. Link to this article: http://www.elpublishing.org/PID/181 This electronic version first published: July 2020 __________________________________________________ This article is published under a Creative Commons License CC-BY-NC (Attribution-NonCommercial). The licence permits users to use, reproduce, disseminate or display the article provided that the author is attributed as the original creator and that the reuse is restricted to non-commercial purposes i.e. research or educational use. See http://creativecommons.org/licenses/by-nc/4.0/ ______________________________________________________ EL Publishing For more EL Publishing articles and services: Website: http://www.elpublishing.org Submissions: http://www.elpublishing.org/submissions Countering the challenges of globalization faced by endangered languages of North Pakistan Zubair Torwali Independent Researcher Summary Indigenous communities living in the mountainous terrain and valleys of the region of Gilgit-Baltistan and upper Khyber Pakhtunkhwa, northern -
Ed 370 413 Author Title Institution Pub Date Note
DOCUMENT RESUME ED 370 413 FL 022 191 AUTHOR Roby, Linda M., Ed. TITLE Kansas Working Papers in Linguistics. Volume 19. INSTITUTION Kansas Univ., Lawrence. Dept. of Linguistics. PUB DATE 94 NOTE 475p.; For individual papers, see FL 022 192-207. AVAILABLE FROMEditors, KWPL, LGSA, Linguistics Department, 427 Blake Hall, University of Kansas, Lawrence, KS 66045. PUB TYPE Collected Works Serials (022) JOURNAL CIT Kansas Working Papers in Linguistics; v19 n1-2 1994 EDRS PRICE MFOI/PC19 Plus Postage. DESCRIPTORS African Languages; American Indian Languages; Chinese; Dakota; *Descriptive Linguistics; English (Second Language); Hausa; Higher Education; Korean; *Language Research; Language Typology; *Linguistics; Native Speakers; Semantics; Sentence Structure; *Structural Analysis (Linguistics); Uncommonly Taught Languages IDENTIFIERS Clitics; Kansa; Karankawa; Xhosa ABSTRACT This collection of papers presents the latest original research by the institutions. The papers in Number 1are: (1) "Xhosa departments of the University of Kansas,as well as contributors from other institutions. The papers in Number Iare: (1) "Xhosa Nominal Tonology: A Domain-Based Approach" (Mbulelo Jokweni); (2) "On the Representation of Mandarin Syllable Structure" (Feng-Lan Kuo);(3) "Vendler Classes and Reinterpretation" (Michihiko Kawamura);(4) "Negative Polarity Items and the Semantics of the Particles '-to' and '-na' in Korean" (Yae-sheik Lee);(5) "Clitics, Case Checking, and Causative Constructions" (Xavier Villalba); (6) "The Dual Status of the Null Object in Chinese" (Yanfeng Qu);(7) "On the Orientation Problem in Korean 'CAKI' Binding and the Typology of X Reflexive Binding" (Mi-Hui Cho);(8) "Complementation of Hausa Aspectual Verbs" (Lawan Danladi Yalwa);(9) "Deriving the Distribution of Conjunctions" (Ed Zoerner); and (10) "L2 Acquisition of English Reflexives by Native Speakers of Korean" (Hye-Ryun Kim). -
TD-30 Data List
Data List Preset Drum Kit List No. Name Pad pattern No. Name Pad pattern 1 Studio 41 RockGig 2 LA Metal 42 Hard BeBop 3 Swingin’ 43 Rock Solid 4 Burnin’ 44 2nd Line 5 Birch 45 ROBO TAP 6 Nashville 46 SATURATED 7 LoudRock 47 piccolo 8 JJ’s DnB 48 FAT 9 Djembe 49 BigHall 10 Stage 50 CoolGig LOOP 11 RockMaster 51 JazzSes LOOP 12 LoudJazz 52 7/4 Beat LOOP 13 Overhead 53 :neotype: 1SHOT, TAP 14 Looooose 54 FLA>n<GER 1SHOT, TAP 15 Fusion 55 CustomWood 16 Room 56 50s King 17 [RadioMIX] 57 BluesRock 18 R&B 58 2HH House 19 Brushes 59 TechFusion 20 Vision LOOP, TAP 60 BeBop 21 AstroNote 1SHOT 61 Crossover 22 acidfunk 62 Skanky 23 PunkRock 63 RoundBdge 24 OpenMaple 64 Metal\Core 25 70s Rock 65 JazzCombo 26 DrySound 66 Spark! 27 Flat&Shallow 67 80sMachine 28 Rvs!Trashy 68 =cosmic= 29 melodious TAP 69 1985 30 HARD n’BASS TAP 70 TR-808 31 BazzKicker 71 TR-909 32 FatPressed 72 LatinDrums 33 DrumnDubStep 73 Latin 34 ReMix-ulator 74 Brazil 35 Acoutronic 75 Cajon 36 HipHop 76 African 37 90sHouse 77 Ka-Rimba 38 D-N-B LOOP 78 Tabla TAP 39 SuperLoop TAP 79 Asian 40 >>process>>> 80 Orchestra TAP Copyright © 2012 ROLAND CORPORATION All rights reserved. No part of this publication may be reproduced in any form without the written permission of ROLAND CORPORATION. Roland and V-Drums are either registered trademarks or trademarks of Roland Corporation in the United States and/or other countries. -
The Linguistic History of Some Indian Domestic Plants the Harvard
The Linguistic History of Some Indian Domestic Plants The Harvard community has made this article openly available. Please share how this access benefits you. Your story matters. Witzel, Michael. 2009. The linguistic history of some Indian Citation domestic plants. Journal of BioSciences 34(6): 829-833. Published Version doi:10.1007/s12038-009-0096-1 Accessed April 17, 2018 3:26:20 PM EDT Citable Link http://nrs.harvard.edu/urn-3:HUL.InstRepos:8954814 This article was downloaded from Harvard University's DASH Terms of Use repository, and is made available under the terms and conditions applicable to Open Access Policy Articles, as set forth at http://nrs.harvard.edu/urn-3:HUL.InstRepos:dash.current.terms- of-use#OAP (Article begins on next page) Michael Witzel, Harvard University [email protected] THE LINGUISTIC HISTORY OF SOME INDIAN DOMESTIC PLANTS From* the mist of times emerge our earliest Indian texts, the Ṛgveda (c. 1300 -1000 BCE), composed in the Northwest of the subcontinent, and the Sangam texts (c. 2nd cent. BCE - early CE), composed in the extreme South. They contain valuable materials in archaic Indo-Aryan (Vedic Sanskrit) and in archaic Old Tamil respectively. The former belongs, along with Old Iranian (Avestan of Zarathustra), to the ancient Indo-Iranian subfamily of Indo-European that stretches from Iceland to Assam and Sri Lanka.1 The latter belongs to the Dravidian family2 that is restricted to the subcontinent but may have relatives in Northern Asia (Uralic) and beyond.3 As for the plant names found in these old sources, it must be observed that recent advances in archaeobotany4 indicate at least three major nuclei of food production in the subcontinent. -
Polity (PRE-Cure)
Polity (PRE-Cure) April 2020 - March 2021 Visit our website www.sleepyclasses.com or our YouTube channel for entire GS Course FREE of cost Also Available: Prelims Crash Course || Prelims Test Series T.me/SleepyClasses Table of Contents Links to the videos on YouTube .................1 32. GARUD Portal ...................................18 1. Punjab Village and Small Towns Act 3 33. Samudra Setu ....................................18 2. Sections 269 & 270 IPC ................3 34. Online Summit of NAM Contact Group 3. Pradhan Mantri Garib Kalyan Yojana 18 3 35. “The Saras Collection” on the 4. New Domicile Rules for J&K .........5 Government e-Marketplace Portal 19 5. Medical Devices notified as Drugs 5 36. Dilution of Labour Laws .................20 6. NPPA ...................................................6 37. Data sharing under Arogya Setu Act 20 7. Lifeline UDAN ...................................6 38. Shetkar Committee recommendations 8. Stranded in India Portal .................6 accepted ...............................................21 9. PM CARES Fund ...............................6 39. GOAL Programme ............................22 10. PMNRF ...............................................7 40. Project Arth Ganga ..........................23 11. National Security Act .....................7 41. One Nation, One Channel- Education 12. MPLAD Scheme ...............................8 Initiatives .............................................23 13. Arogya Setu .......................................9 42. National Test Abhyaas App ...........24