The CSIRO Collection of Living Microalgae: an Australian Perspective on Microalgal Biodiversity and Applications

Total Page:16

File Type:pdf, Size:1020Kb

Load more

The CSIRO Collection of Living Microalgae: An Australian Perspective on Microalgal Biodiversity and Applications S.I. Blackburn, I.D. Jameson, D. Frampton, M. Brown, M. Mansour, A. Negri, N.S. Parker, S. Robert, C.J. Bolch, P.D. Nichols and J.K. Volkman CSIRO Marine Research, Hobart, Tasmania, Australia [email protected] [email protected] ABSTRACT The CSIRO Collection of Living Microalgae maintains over 800 strains from 140 genera representing the majority of marine and some freshwater microalgal classes. The Collection is incorpoarted within the CSIRO Microalgal Research Centre (CMARC) which provides a supply service of microalgal strains to industry, government and university organizations. Research within CMARC and in partnership with collaborators spans a wide base within the three themes of Environment, Aquaculture and Biotechnology. Some of the research projects undertaken include physiological studies of different life-history stages of microalgae, toxin production in harmful algal bloom (HAB) species, phylogenetic studies of different populations of HAB species, optimizing the nutritional benefit of microalgal diets in larval and broodstock aquaculture species, including important nutrients such as vitamins and polyunstaurated fatty acids. Research is also being undertaken into optimizing high biomass production systems through the use of photobioreactors. 1. THE CSIRO COLLECTION OF LIVING MICROALGAE The CSIRO Collection of Living Microalgae maintains over 800 strains from 140 genera representing the majority of marine and some freshwater microalgal classes (see Fig.1 for summary, list of strains available from the authors or downloadable from http://www.marine.csiro.au). There are also some selected micro-heterotrophic strains. This collection is the largest and most diverse microalgal culture collection in Australia and, with NIES-Collection (National Institute for Environmental Studies, Environment Agency) in Japan, ranks as a major microalgal collection in the the Asia-Pacific region. 1-1. Development of the CSIRO Collection of Living Microalgae The collection originated in the 1960s from fundamental research into the pigment composition of marine microalgae, a theme which has continued through to the present and which has culminated in the incorporation of microalgal pigments as essential oceanographic reference standards (Jeffrey et al.1997). The aquisition of microalgal strains has focused on isolates from Australian waters - over 80% of strains have been isolated from diverse localities and climatic zones, from tropical northern Australia to the Australian Antarctic Territory, from oceanic, inshore coastal, estuarine, intertidal and freshwater environments (Fig. 2). Additionally, emphasis has also been placed on representation of 39 different populations of a single species, usually by more than one strain. This is particularly the case for harmful bloom-forming species where there are up to 20 strains of a single species from a single locality. 250 40 strains N= 803 35 200 genera N=139 30 150 25 20 100 15 10 50 5 number of strains per Class number of genera per Class 0 0 Dinophyceae Cyanophyceae Cryptophyceae Chlorophyceae Rhodophyceae Chrysophyceae Xanthophyceae Prasinophyceae Euglenophyceae Raphidophyceae Bacillariophyceae Dictyochophyceae Prymnesiophyceae Eustigmatophyceae Fig. 1. Number of strains and genera in different algal classes held in the CSIRO collection of living microalgae. 250 Australian Overseas 200 150 100 Number of strains 50 0 Other Dinophyceae Cyanophyceae Cryptophyceae Rhodophyceae Chlorophyceae Chrysophyceae Prasinophyceae Euglenophyceae Raphidophyceae Bacillariophyceae Dictyochophyceae Prymnesiophyceae Eustigmatophyceae Fig. 2. Number of strains of Australian and non-Australian origin in different classes held in the CSIRO collection of living microalage. 40 All strains in the culture collection are unialgal and the majority are clonal. A subset of strains, including particular strains used by the aquaculture industry and some used for genetic and toxin profiles, are axenic. Since the mid 1980s research has focused on the rapidly developing aquaculture industry in Australia and key environmental issues such as harmful and toxic algal blooms. Since 1995 the potential for biotechnological development of bioactive and novel compounds, particularly lipids, from microalgae has been explored. In parallel, the issue of efficient, high production of quality-controlled microalgae using photobioreactors has been a research focus. Such systems will allow the full potential of microalgae for biotechnology and aquaculture applications to be realized. 1-2. Genetic Diversity Microalgae are known for their cosmopolitanism at the morphological species level, with very low endemicity being shown (Norton et al.1996). However this morphological cosmopolitanism can hide a plethora of diversity at the intra-specific level. There have been a number of studies of genetic diversity on different microalgae using various approaches such as interbreeding, isozymes, growth rates and a range of molecular genetic techniques. The diversity identified by these studies ranges from large regional and global scales (Chinain et al.,1997) to between and within populations at small scales (Gallagher, 1980; Medlin et al.,1996; Bolch et al.,1999a,b). Variation at the intra-specific level, between morphologically indistinguishable microalgae, can usually only be identified using strains isolated from the natural environment and cultured in the laboratory. For selected microalgae we have demonstrated the distinctness of Australian populations compared with populations from outside Australia. The dinoflagellate Gymnodinium catenatum has formed recurrent toxic blooms in south-eastern Tasmanian waters since 1986. Cargo vessel ballast water from Japan or Spain has been proposed as one likely vector of introduction. Using both interbreeding and molecular approaches we have shown considerable within-population variation in G. catenatum as well as a complex multi-group mating system. The interbreeding data showed a slightly closer relationship between Tasmanian and Spanish populations than between Tasmanian and Japanese populations (Blackburn et al.2001), whereas multidimensional scaling analysis (MDS) of Randomly Amplified Polymorphic DNA (RAPD) indicated that Australian strains were almost equally related to both the Spanish/Portuguese population and the Japanese population (Bolch et al.1999b). Analysis of molecular variance (AMOVA) found that genetic variation was partitioned mainly within the Tasmanian populations (87%) compared to the variation between the regions (8%) and between populations within regions (5%). The potential source population for Tasmania’s introduced G. catenatum remains equivocal; however, strains from the more recently discovered mainland Australian population (Port Lincoln, South Australia, 1996) clustered with Tasmanian strains, supporting the notion of a secondary relocation of Tasmanian G. catenatum populations to the mainland via a shipping vector. Geographic and temporal clustering of strains was evident among the Tasmanian strains, indicating that genetic exchange between neighboring estuaries is limited and that Tasmanian G. catenatum blooms are composed of localized, estuary-bound subpopulations (Fig. 3). Another phylogenetic study of the toxic cyanobacterial bloom-forming species Nodularia 41 spumigena highlighted some similar findings. Australian populations of N. spumigena were distinctly different from Nodularia strains from Canada and Europe including the proposed type strain for the species. Within Nodularia strains, genetic variation could be resolved at several levels, from intra-generic through to intra-population levels, clearly defining generic, species and population limits of genetic variation in these clonal organisms (Bolch et al.1999a). Unlike G. catenatum, within population heterogeneity was not high in Australian N. spumigena. This may reflect a difference in genetic complexity and life history between these eutcaryotic and prokaryotic microalgae. Culture collections maintain living and characterised biodiversity for research and comparison with new strain acquisitions as well as with natural biodiversity. It is essential to have identifiable and stable genotypes. While there are recorded instances of change or loss of particular characteristics in long term culture (Coleman, 1977), in general, culturing guarantees genetic continuity and stability of a particular strain. We are now developing cryopreservation strategies to limit the potential for genetic drift, beginning with our cyanobacterial subset of strains. Cryopreservation is also attractive because it decreases the demanding task of regular subculturing. 1 HU JP TRA DE '93 ) 3 0 ( PT M I D DE '87 SP PTL02 PTL01-4 -1 -2 -1012 DIM (1) Fig. 3. Three-dimensional MDS analysis of RAPD data from G. catenatum strains, not including the two outgroup species. Kruskal stress = 0.193. (a) Plot of first and second dimension of the three-dimensional MDS analysis of G. catenatum strains. Region/population clusters (bounded by solid line): Huon Estuary and Hastings Bay (HU/HA), Derwent Estuary 1987 (DE”87) and 1993 (DE’93), Triabunna (TRA), and Japan, Spain and Portugal (JP/SP/PT). Port Lincoln, South Australia strains (PTL) marked by strain number. (b) Plot of the first and third dimension of the three-dimensional MDS analysis of G. catenatum strains. G. catenatum clusters bounded by solid or shaded lines: Huon Estuary
Recommended publications
  • University of Oklahoma

    University of Oklahoma

    UNIVERSITY OF OKLAHOMA GRADUATE COLLEGE MACRONUTRIENTS SHAPE MICROBIAL COMMUNITIES, GENE EXPRESSION AND PROTEIN EVOLUTION A DISSERTATION SUBMITTED TO THE GRADUATE FACULTY in partial fulfillment of the requirements for the Degree of DOCTOR OF PHILOSOPHY By JOSHUA THOMAS COOPER Norman, Oklahoma 2017 MACRONUTRIENTS SHAPE MICROBIAL COMMUNITIES, GENE EXPRESSION AND PROTEIN EVOLUTION A DISSERTATION APPROVED FOR THE DEPARTMENT OF MICROBIOLOGY AND PLANT BIOLOGY BY ______________________________ Dr. Boris Wawrik, Chair ______________________________ Dr. J. Phil Gibson ______________________________ Dr. Anne K. Dunn ______________________________ Dr. John Paul Masly ______________________________ Dr. K. David Hambright ii © Copyright by JOSHUA THOMAS COOPER 2017 All Rights Reserved. iii Acknowledgments I would like to thank my two advisors Dr. Boris Wawrik and Dr. J. Phil Gibson for helping me become a better scientist and better educator. I would also like to thank my committee members Dr. Anne K. Dunn, Dr. K. David Hambright, and Dr. J.P. Masly for providing valuable inputs that lead me to carefully consider my research questions. I would also like to thank Dr. J.P. Masly for the opportunity to coauthor a book chapter on the speciation of diatoms. It is still such a privilege that you believed in me and my crazy diatom ideas to form a concise chapter in addition to learn your style of writing has been a benefit to my professional development. I’m also thankful for my first undergraduate research mentor, Dr. Miriam Steinitz-Kannan, now retired from Northern Kentucky University, who was the first to show the amazing wonders of pond scum. Who knew that studying diatoms and algae as an undergraduate would lead me all the way to a Ph.D.
  • The State of the World's Aquatic Genetic Resources for Food and Agriculture 1

    The State of the World's Aquatic Genetic Resources for Food and Agriculture 1

    2019 ISSN 2412-5474 THE STATE OF THE WORLD’S AQUATIC GENETIC RESOURCES FOR FOOD AND AGRICULTURE FAO COMMISSION ON GENETIC RESOURCES FOR FOOD AND AGRICULTURE ASSESSMENTS • 2019 FAO COMMISSION ON GENETIC RESOURCES FOR FOOD AND AGRICULTURE ASSESSMENTS • 2019 THE STATE OF THE WORLD’S AQUATIC GENETIC RESOURCES FOR FOOD AND AGRICULTURE COMMISSION ON GENETIC RESOURCES FOR FOOD AND AGRICULTURE FOOD AND AGRICULTURE ORGANIZATION OF THE UNITED NATIONS ROME 2019 Required citation: FAO. 2019. The State of the World’s Aquatic Genetic Resources for Food and Agriculture. FAO Commission on Genetic Resources for Food and Agriculture assessments. Rome. The designations employed and the presentation of material in this information product do not imply the expression of any opinion whatsoever on the part of the Food and Agriculture Organization of the United Nations (FAO) concerning the legal or development status of any country, territory, city or area or of its authorities, or concerning the delimitation of its frontiers or boundaries. The mention of specific companies or products of manufacturers, whether or not these have been patented, does not imply that these have been endorsed or recommended by FAO in preference to others of a similar nature that are not mentioned. The views expressed in this information product are those of the author(s) and do not necessarily reflect the views or policies of FAO. ISBN 978-92-5-131608-5 © FAO, 2019 Some rights reserved. This work is available under a CC BY-NC-SA 3.0 IGO licence 2018 © FAO, XXXXXEN/1/05.18 Some rights reserved. This work is made available under the Creative Commons Attribution-NonCommercial- ShareAlike 3.0 IGO licence (CC BY-NC-SA 3.0 IGO; https://creativecommons.org/licenses/by-nc-sa/3.0/igo/ legalcode).
  • Old Woman Creek National Estuarine Research Reserve Management Plan 2011-2016

    Old Woman Creek National Estuarine Research Reserve Management Plan 2011-2016

    Old Woman Creek National Estuarine Research Reserve Management Plan 2011-2016 April 1981 Revised, May 1982 2nd revision, April 1983 3rd revision, December 1999 4th revision, May 2011 Prepared for U.S. Department of Commerce Ohio Department of Natural Resources National Oceanic and Atmospheric Administration Division of Wildlife Office of Ocean and Coastal Resource Management 2045 Morse Road, Bldg. G Estuarine Reserves Division Columbus, Ohio 1305 East West Highway 43229-6693 Silver Spring, MD 20910 This management plan has been developed in accordance with NOAA regulations, including all provisions for public involvement. It is consistent with the congressional intent of Section 315 of the Coastal Zone Management Act of 1972, as amended, and the provisions of the Ohio Coastal Management Program. OWC NERR Management Plan, 2011 - 2016 Acknowledgements This management plan was prepared by the staff and Advisory Council of the Old Woman Creek National Estuarine Research Reserve (OWC NERR), in collaboration with the Ohio Department of Natural Resources-Division of Wildlife. Participants in the planning process included: Manager, Frank Lopez; Research Coordinator, Dr. David Klarer; Coastal Training Program Coordinator, Heather Elmer; Education Coordinator, Ann Keefe; Education Specialist Phoebe Van Zoest; and Office Assistant, Gloria Pasterak. Other Reserve staff including Dick Boyer and Marje Bernhardt contributed their expertise to numerous planning meetings. The Reserve is grateful for the input and recommendations provided by members of the Old Woman Creek NERR Advisory Council. The Reserve is appreciative of the review, guidance, and council of Division of Wildlife Executive Administrator Dave Scott and the mapping expertise of Keith Lott and the late Steve Barry.
  • Fig.S1. the Pairwise Aligments of High Scoring Pairs of Recognizable Pseudogenes

    Fig.S1. the Pairwise Aligments of High Scoring Pairs of Recognizable Pseudogenes

    LysR transcriptional regulator Identities = 57/164 (35%), Positives = 82/164 (50%), Gaps = 13/164 (8%) 70530- SNQAIKTYLMPK*LRLLRQK*SPVEFQLQVHLIKKIRLNIVIRDINLTIIEN-TPVKLKI -70354 ++Q TYLMP+ + L RQK V QLQVH ++I ++ INL II P++LK 86251- ASQTTGTYLMPRLIGLFRQKYPQVAVQLQVHSTRRIAWSVANGHINLAIIGGEVPIELKN -86072 70353- FYTLLRMKERI*H*YCLGFL------FQFLIAYKKKNLYGLRLIKVDIPFPIRGIMNNP* -70192 + E L + F L + +K++LY LR I +D IR +++ 86071- MLQVTSYAED-----ELALILPKSHPFSMLRSIQKEDLYRLRFIALDRQSTIRKVIDKVL -85907 70191- IKTELIPRNLN-EMELSLFKPIKNAV*PGLNVTLIFVSAIAKEL -70063 + + EMEL+ + IKNAV GL + VSAIAKEL 85906- NQNGIDSTRFKIEMELNSVEAIKNAVQSGLGAAFVSVSAIAKEL -85775 ycf3 Photosystem I assembly protein Identities = 25/59 (42%), Positives = 39/59 (66%), Gaps = 3/59 (5%) 19162- NRSYML-SIQCM-PNNSDYVNTLKHCR*ALDLSSKL-LAIRNVTISYYCQDIIFSEKKD -19329 +RSY+L +I + +N +YV L++ ALDL+S+L AI N+ + Y+ Q + SEKKD 19583- DRSYILYNIGLIYASNGEYVKALEYYHQALDLNSRLPPAINNIAVIYHYQGVKASEKKD -19759 Fig.S1. The pairwise aligments of high scoring pairs of recognizable pseudogenes. The upper amino acid sequences indicates Cryptomonas sp. SAG977-2f. The lower sequences are corresponding amino acid sequences of homologs in C. curvata CCAP979/52. Table S1. Presence/absence of protein genes in the plastid genomes of Cryptomonas and representative species of Cryptomonadales. Note; y indicates pseudogenes. Photosynthetic Non-Photosynthetic Guillardia Rhodomonas Cryptomonas C. C. curvata C. curvata parameciu Guillardia Rhodomonas FBCC300 CCAP979/ SAG977 CCAC1634 m theta salina -2f B 012D 52 CCAP977/2 a rps2 + + + +
  • Assessment of Transoceanic NOBOB Vessels and Low-Salinity Ballast Water As Vectors for Non-Indigenous Species Introductions to the Great Lakes

    Assessment of Transoceanic NOBOB Vessels and Low-Salinity Ballast Water As Vectors for Non-Indigenous Species Introductions to the Great Lakes

    A Final Report for the Project Assessment of Transoceanic NOBOB Vessels and Low-Salinity Ballast Water as Vectors for Non-indigenous Species Introductions to the Great Lakes Principal Investigators: Thomas Johengen, CILER-University of Michigan David Reid, NOAA-GLERL Gary Fahnenstiel, NOAA-GLERL Hugh MacIsaac, University of Windsor Fred Dobbs, Old Dominion University Martina Doblin, Old Dominion University Greg Ruiz, Smithsonian Institution-SERC Philip Jenkins, Philip T Jenkins and Associates Ltd. Period of Activity: July 1, 2001 – December 31, 2003 Co-managed by Cooperative Institute for Limnology and Ecosystems Research School of Natural Resources and Environment University of Michigan Ann Arbor, MI 48109 and NOAA-Great Lakes Environmental Research Laboratory 2205 Commonwealth Blvd. Ann Arbor, MI 48105 April 2005 (Revision 1, May 20, 2005) Acknowledgements This was a large, complex research program that was accomplished only through the combined efforts of many persons and institutions. The Principal Investigators would like to acknowledge and thank the following for their many activities and contributions to the success of the research documented herein: At the University of Michigan, Cooperative Institute for Limnology and Ecosystem Research, Steven Constant provided substantial technical and field support for all aspects of the NOBOB shipboard sampling and maintained the photo archive; Ying Hong provided technical laboratory and field support for phytoplankton experiments and identification and enumeration of dinoflagellates in the NOBOB residual samples; and Laura Florence provided editorial support and assistance in compiling the Final Report. At the Great Lakes Institute for Environmental Research, University of Windsor, Sarah Bailey and Colin van Overdijk were involved in all aspects of the NOBOB shipboard sampling and conducted laboratory analyses of invertebrates and invertebrate resting stages.
  • Biovolumes and Size-Classes of Phytoplankton in the Baltic Sea

    Biovolumes and Size-Classes of Phytoplankton in the Baltic Sea

    Baltic Sea Environment Proceedings No.106 Biovolumes and Size-Classes of Phytoplankton in the Baltic Sea Helsinki Commission Baltic Marine Environment Protection Commission Baltic Sea Environment Proceedings No. 106 Biovolumes and size-classes of phytoplankton in the Baltic Sea Helsinki Commission Baltic Marine Environment Protection Commission Authors: Irina Olenina, Centre of Marine Research, Taikos str 26, LT-91149, Klaipeda, Lithuania Susanna Hajdu, Dept. of Systems Ecology, Stockholm University, SE-106 91 Stockholm, Sweden Lars Edler, SMHI, Ocean. Services, Nya Varvet 31, SE-426 71 V. Frölunda, Sweden Agneta Andersson, Dept of Ecology and Environmental Science, Umeå University, SE-901 87 Umeå, Sweden, Umeå Marine Sciences Centre, Umeå University, SE-910 20 Hörnefors, Sweden Norbert Wasmund, Baltic Sea Research Institute, Seestr. 15, D-18119 Warnemünde, Germany Susanne Busch, Baltic Sea Research Institute, Seestr. 15, D-18119 Warnemünde, Germany Jeanette Göbel, Environmental Protection Agency (LANU), Hamburger Chaussee 25, D-24220 Flintbek, Germany Slawomira Gromisz, Sea Fisheries Institute, Kollataja 1, 81-332, Gdynia, Poland Siv Huseby, Umeå Marine Sciences Centre, Umeå University, SE-910 20 Hörnefors, Sweden Maija Huttunen, Finnish Institute of Marine Research, Lyypekinkuja 3A, P.O. Box 33, FIN-00931 Helsinki, Finland Andres Jaanus, Estonian Marine Institute, Mäealuse 10 a, 12618 Tallinn, Estonia Pirkko Kokkonen, Finnish Environment Institute, P.O. Box 140, FIN-00251 Helsinki, Finland Iveta Ledaine, Inst. of Aquatic Ecology, Marine Monitoring Center, University of Latvia, Daugavgrivas str. 8, Latvia Elzbieta Niemkiewicz, Maritime Institute in Gdansk, Laboratory of Ecology, Dlugi Targ 41/42, 80-830, Gdansk, Poland All photographs by Finnish Institute of Marine Research (FIMR) Cover photo: Aphanizomenon flos-aquae For bibliographic purposes this document should be cited to as: Olenina, I., Hajdu, S., Edler, L., Andersson, A., Wasmund, N., Busch, S., Göbel, J., Gromisz, S., Huseby, S., Huttunen, M., Jaanus, A., Kokkonen, P., Ledaine, I.
  • Diversity and Evolution of Protist Mitochondria: Introns, Gene Content and Genome Architecture

    Diversity and Evolution of Protist Mitochondria: Introns, Gene Content and Genome Architecture

    Diversity and Evolution of Protist Mitochondria: Introns, Gene Content and Genome Architecture 著者 西村 祐貴 内容記述 この博士論文は内容の要約のみの公開(または一部 非公開)になっています year 2016 その他のタイトル プロティストミトコンドリアの多様性と進化:イン トロン、遺伝子組成、ゲノム構造 学位授与大学 筑波大学 (University of Tsukuba) 学位授与年度 2015 報告番号 12102甲第7737号 URL http://hdl.handle.net/2241/00144261 Diversity and Evolution of Protist Mitochondria: Introns, Gene Content and Genome Architecture A Dissertation Submitted to the Graduate School of Life and Environmental Sciences, the University of Tsukuba in Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy in Science (Doctral Program in Biologial Sciences) Yuki NISHIMURA Table of Contents Abstract ........................................................................................................................... 1 Genes encoded in mitochondrial genomes of eukaryotes ..................................................... 3 Terminology .......................................................................................................................... 4 Chapter 1. General introduction ................................................................................ 5 The origin and evolution of mitochondria ............................................................................ 5 Mobile introns in mitochondrial genome .............................................................................. 6 The organisms which are lacking in mitochondrial genome data ........................................ 8 Chapter 2. Lateral transfers of mobile introns
  • Barthelonids Represent a Deep-Branching Metamonad Clade with Mitochondrion-Related Organelles Generating No

    Barthelonids Represent a Deep-Branching Metamonad Clade with Mitochondrion-Related Organelles Generating No

    bioRxiv preprint doi: https://doi.org/10.1101/805762; this version posted October 29, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 1 2 3 Barthelonids represent a deep-branching Metamonad clade with mitochondrion-related 4 organelles generating no ATP. 5 6 Euki Yazaki1*, Keitaro Kume2, Takashi Shiratori3, Yana Eglit 4,5,, Goro Tanifuji6, Ryo 7 Harada7, Alastair G.B. Simpson4,5, Ken-ichiro Ishida7,8, Tetsuo Hashimoto7,8 and Yuji 8 Inagaki7,9* 9 10 1Department of Biochemistry and Molecular Biology, Graduate School and Faculty of 11 Medicine, The University of Tokyo, Tokyo, Japan 12 2Faculty of Medicine, University of Tsukuba, Ibaraki, Japan 13 3Department of Marine Diversity, Japan Agency for Marine-Earth Science and Technology, 14 Yokosuka, Japan 15 4Department of Biology, Dalhousie University, Halifax, Nova Scotia, Canada 16 5Centre for Comparative Genomics and Evolutionary Bioinformatics, Dalhousie University, 17 Halifax, Nova Scotia, Canada 18 6Department of Zoology, National Museum of Nature and Science, Ibaraki, Japan 19 7Graduate School of Life and Environmental Sciences, University of Tsukuba, Tsukuba, 20 Ibaraki, Japan 21 8Faculty of Life and Environmental Sciences, University of Tsukuba, Ibaraki, Japan 22 9Center for Computational Sciences, University of Tsukuba, Tsukuba, Ibaraki, Japan 23 24 Running head: Phylogeny and putative MRO functions in a new metamonad clade. 25 26 *Correspondence addressed to Euki Yazaki, [email protected] and Yuji Inagaki, 27 [email protected] 1 bioRxiv preprint doi: https://doi.org/10.1101/805762; this version posted October 29, 2019.
  • Lateral Gene Transfer of Anion-Conducting Channelrhodopsins Between Green Algae and Giant Viruses

    Lateral Gene Transfer of Anion-Conducting Channelrhodopsins Between Green Algae and Giant Viruses

    bioRxiv preprint doi: https://doi.org/10.1101/2020.04.15.042127; this version posted April 23, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 1 5 Lateral gene transfer of anion-conducting channelrhodopsins between green algae and giant viruses Andrey Rozenberg 1,5, Johannes Oppermann 2,5, Jonas Wietek 2,3, Rodrigo Gaston Fernandez Lahore 2, Ruth-Anne Sandaa 4, Gunnar Bratbak 4, Peter Hegemann 2,6, and Oded 10 Béjà 1,6 1Faculty of Biology, Technion - Israel Institute of Technology, Haifa 32000, Israel. 2Institute for Biology, Experimental Biophysics, Humboldt-Universität zu Berlin, Invalidenstraße 42, Berlin 10115, Germany. 3Present address: Department of Neurobiology, Weizmann 15 Institute of Science, Rehovot 7610001, Israel. 4Department of Biological Sciences, University of Bergen, N-5020 Bergen, Norway. 5These authors contributed equally: Andrey Rozenberg, Johannes Oppermann. 6These authors jointly supervised this work: Peter Hegemann, Oded Béjà. e-mail: [email protected] ; [email protected] 20 ABSTRACT Channelrhodopsins (ChRs) are algal light-gated ion channels widely used as optogenetic tools for manipulating neuronal activity 1,2. Four ChR families are currently known. Green algal 3–5 and cryptophyte 6 cation-conducting ChRs (CCRs), cryptophyte anion-conducting ChRs (ACRs) 7, and the MerMAID ChRs 8. Here we 25 report the discovery of a new family of phylogenetically distinct ChRs encoded by marine giant viruses and acquired from their unicellular green algal prasinophyte hosts.
  • Chloroplast Structure of the Cryptophyceae

    Chloroplast Structure of the Cryptophyceae

    CHLOROPLAST STRUCTURE OF THE CRYPTOPHYCEAE Evidence for Phycobiliproteins within Intrathylakoidal Spaces E . GANTT, M . R . EDWARDS, and L . PROVASOLI From the Radiation Biology Laboratory, Smithsonian Institution, Rockville, Maryland 20852, the Division of Laboratories and Research, New York State Department of Health, Albany, New York 12201, and the Haskins Laboratories, New Haven, Connecticut 06520 ABSTRACT Selective extraction and morphological evidence indicate that the phycobiliproteins in three Cryptophyceaen algae (Chroomonas, Rhodomonas, and Cryptomonas) are contained within intrathylakoidal spaces and are not on the stromal side of the lamellae as in the red and blue-green algae . Furthermore, no discrete phycobilisome-type aggregates have thus far been observed in the Cryptophyceae . Structurally, although not necessarily functionally, this is a radical difference . The width of the intrathylakoidal spaces can vary but is gen- erally about 200-300 A . While the thylakoid membranes are usually closely aligned, grana- type fusions do not occur. In Chroomonas these membranes evidence an extensive periodic display with a spacing on the order of 140-160 A . This periodicity is restricted to the mem- branes and has not been observed in the electron-opaque intrathylakoidal matrix . INTRODUCTION The varied characteristics of the cryptomonads (3), Greenwood in Kirk and Tilney-Bassett (10), are responsible for their indefinite taxonomic and Lucas (13) . The thylakoids have a tendency position (17), but at the same time they enhance to be arranged in pairs, that is, for two of them to their status in evolutionary schemes (1, 4) . Their be closely associated with a 30-50 A space between chloroplast structure is distinct from that of every them .
  • Introns, Gene Content and Genome Architecture

    Introns, Gene Content and Genome Architecture

    Diversity and Evolution of Protist Mitochondria: Introns, Gene Content and Genome Architecture A Dissertation Submitted to the Graduate School of Life and Environmental Sciences, the University of Tsukuba in Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy in Science (Doctral Program in Biologial Sciences) Yuki NISHIMURA Table of Contents Abstract ........................................................................................................................... 1 Genes encoded in mitochondrial genomes of eukaryotes ..................................................... 3 Terminology .......................................................................................................................... 4 Chapter 1. General introduction ................................................................................ 5 The origin and evolution of mitochondria ............................................................................ 5 Mobile introns in mitochondrial genome .............................................................................. 6 The organisms which are lacking in mitochondrial genome data ........................................ 8 Chapter 2. Lateral transfers of mobile introns among distantly related mitochondrial genomes ................................................................................................ 11 Summary ................................................................................................................................ 11 2-1. Leucocryptos
  • Nanoplankton Protists from the Western Mediterranean Sea. II. Cryptomonads (Cryptophyceae = Cryptomonadea)*

    Nanoplankton Protists from the Western Mediterranean Sea. II. Cryptomonads (Cryptophyceae = Cryptomonadea)*

    sm69n1047 4/3/05 20:30 Página 47 SCI. MAR., 69 (1): 47-74 SCIENTIA MARINA 2005 Nanoplankton protists from the western Mediterranean Sea. II. Cryptomonads (Cryptophyceae = Cryptomonadea)* GIANFRANCO NOVARINO Department of Zoology, The Natural History Museum, Cromwell Road, London SW7 5BD, U.K. E-mail: [email protected] SUMMARY: This paper is an electron microscopical account of cryptomonad flagellates (Cryptophyceae = Cryptomon- adea) in the plankton of the western Mediterranean Sea. Bottle samples collected during the spring-summer of 1998 in the Sea of Alboran and Barcelona coastal waters contained a total of eleven photosynthetic species: Chroomonas (sensu aucto- rum) sp., Cryptochloris sp., 3 species of Hemiselmis, 3 species of Plagioselmis including Plagioselmis nordica stat. nov/sp. nov., Rhinomonas reticulata (Lucas) Novarino, Teleaulax acuta (Butcher) Hill, and Teleaulax amphioxeia (Conrad) Hill. Identification was based largely on cell surface features, as revealed by scanning electron microscopy (SEM). Cells were either dispersed in the water-column or associated with suspended particulate matter (SPM). Plagioselmis prolonga was the most common species both in the water-column and in association with SPM, suggesting that it might be a key primary pro- ducer of carbon. Taxonomic keys are given based on SEM. Key words: Cryptomonadea, cryptomonads, Cryptophyceae, flagellates, nanoplankton, taxonomy, ultrastructure. RESUMEN: PROTISTAS NANOPLANCTÓNICOS DEL MAR MEDITERRANEO NOROCCIDENTAL II. CRYPTOMONADALES (CRYPTOPHY- CEAE = CRYPTOMONADEA). – Este estudio describe a los flagelados cryptomonadales (Cryptophyceae = Cryptomonadea) planctónicos del Mar Mediterraneo Noroccidental mediante microscopia electrónica. La muestras recogidas en botellas durante la primavera-verano de 1998 en el Mar de Alboran y en aguas costeras de Barcelona, contenian un total de 11 espe- cies fotosintéticas: Chroomonas (sensu auctorum) sp., Cryptochloris sp., 3 especies de Hemiselmis, 3 especies de Plagio- selmis incluyendo Plagioselmis nordica stat.